SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013140 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013140
Domain Number 1 Region: 298-424
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000353
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 4-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000097
Family EGF-type module 0.0028
Further Details:      
 
Domain Number 3 Region: 426-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000157
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 4 Region: 501-544
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000146
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 5 Region: 144-277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 45-160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000119
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 7 Region: 466-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000204
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013140
Domain Number - Region: 278-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00492
Family EGF-type module 0.0066
Further Details:      
 
Domain Number - Region: 536-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0805
Family EGF-type module 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013140   Gene: ENSTGUG00000012763   Transcript: ENSTGUT00000013289
Sequence length 564
Comment pep:novel chromosome:taeGut3.2.4:3:87462880:87620958:1 gene:ENSTGUG00000012763 transcript:ENSTGUT00000013289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CEIEVNECLSDPCHNGATCVDHLNAFSCICQDGFEGTTCEANINECQSSLCLHNASCADL
IGGYKCVCLPGFTGELCETDIDECASIPCKNGATCIDQPGNYFCQCCVKGFAGPRCEINV
NECSSNPCLHGYCYDIVDGFYCLCNPGYAGLKCDQDIDDCIVNACEHNSTCVDLRLRYQC
DCLSGWEGKFCEKESNECNSEPCRNNGTCMDLFNSYRCTCTAGWTGPDCSEDINECESEP
CLNGATCFESVKPGQFVCICPPFYTGTLCEVEINECLSRPCKNNGTCLDLLNRFICNCAP
GYYGSLCEMDVNECETLPCLHGGSCINRLGGYRCLCLLGFTGHRCEVNIDECMSSPCLNN
GSCIDGISSYKCHCKQGFTGTNCEININECLPNPCLHGRLNDMGNLIDGYQCSCEPGWTS
SRCEININECESAPCINGGSCQDAINAFVCVCLSGYTGRFCEVDVDVCILCYNGGVCVDG
PGRTFNCRCLAGFSGQFCEIEVNECNSSPCLHGSTCTDHINGYSCKCQQGFKGRSCELNY
NDCLIHSCSTGFLCVDGINNITCL
Download sequence
Identical sequences H0ZR97
ENSTGUP00000013140 59729.ENSTGUP00000013140 ENSTGUP00000013140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]