SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013142 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013142
Domain Number 1 Region: 203-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000105
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 329-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000349
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 3 Region: 140-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000219
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 4 Region: 20-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000036
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 58-102
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000406
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 100-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000785
Family EGF-type module 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013142
Domain Number - Region: 177-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00011
Family EGF-type module 0.0056
Further Details:      
 
Domain Number - Region: 3-24
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00326
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013142   Gene: ENSTGUG00000012763   Transcript: ENSTGUT00000013291
Sequence length 397
Comment pep:novel chromosome:taeGut3.2.4:3:87507474:87557778:1 gene:ENSTGUG00000012763 transcript:ENSTGUT00000013291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQRYQCDCLSGWEGKFCEKESNECNSEPCRNNGTCMDLFNSYRCTCTAGWTGPDCSEDIN
ECESEPCLNGATCFESVKPGQFVCICPPFYTGDFCHQRFSPCELPYNPCINNSTCLAQVD
GSPMCICKTGFEGTYCEVNSDECISHPCQNGGLCVDGVNHYRCSCQHGFTGTLCEVEINE
CLSRPCKNNGTCLDLLNRFICNCAPGYYGSLCEMDVNECETLPCLHGGSCINRLGGYRCL
CLLGFTGHRCEVNIDECMSSPCLNNGSCIDGISSYKCHCKQGFTGTNCEININECLPNPC
LHGSRCIDLIDGYQCSCEPGWTSSRCEININECESAPCINGGSCQDAINAFVCVCLSGYT
GRFCEVDVDVCSESTLNSVLCYNGGVCVDGPGRTFNC
Download sequence
Identical sequences H0ZR99
ENSTGUP00000013142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]