SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013146 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013146
Domain Number 1 Region: 192-375
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.31e-26
Family Laminin G-like module 0.0073
Further Details:      
 
Domain Number 2 Region: 1-139
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-20
Family Laminin G-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 130-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000373
Family EGF-type module 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013146   Gene: ENSTGUG00000012769   Transcript: ENSTGUT00000013295
Sequence length 398
Comment pep:novel chromosome:taeGut3.2.4:3:87957847:87959043:1 gene:ENSTGUG00000012769 transcript:ENSTGUT00000013295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFLCISLVNGFTQLRYNLGDRTVILQTLQKVHTNGNTWHLLNAGRVGNEGYLDLDGINIT
QKASPGMNALDTHSDFFVGGVSSLNLVNPMAIENEPTGFTGCIREIVINNRELNLTVTDP
KGGANIGDCDGTDCGYTVCKNNGTCHVENSGFSCSCLREWTGTMCEQSIHCSQNMCGSHA
LCIPQPSSFSYTCACALGWTGKYCDTKIKFYIAKFVGNSYIKYTDPFYGKRDLQYSRLSL
NFTTNQTEGLIAWMGKSEDEDNDFLAIGLANGTLKVVINLGERISVPLMHRKYFTCSDGR
WHFTTVVQNQTCIKVYLDEELILFEDIDPQRKYTALNYGGICYFGGFEIGKEVNIVTIGL
FQKEFIGKIKDVVLFQDSKKIPLMKAEGYNIHDGNSEN
Download sequence
Identical sequences H0ZRA3
59729.ENSTGUP00000013146 ENSTGUP00000013146 ENSTGUP00000013146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]