SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013159 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013159
Domain Number 1 Region: 144-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 2 Region: 114-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000261
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 63-105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000453
Family EGF-type module 0.011
Further Details:      
 
Domain Number 4 Region: 187-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000653
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013159
Domain Number - Region: 39-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00719
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013159   Gene: ENSTGUG00000012776   Transcript: ENSTGUT00000013308
Sequence length 354
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:50244126:50254271:1 gene:ENSTGUG00000012776 transcript:ENSTGUT00000013308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVNCKAGCHPENGFCEFPSECRCQPGWQGALCNQCVPFPGCLHGSCAKPWQCICEEGWVG
SLCDIDIHPCSAKPCTNNSTCIETGDGGYICLCAQGFTGKNCHLKQGPCIINGSPCQNGG
TCIDDNGFAPHASCLCPSGFAGNFCEIDRDDCESSPCENGGTCTDVGVGFSCSCPYGYTG
KLCSSRVTFCASGPCENGGTCSEHPQGGFECICKPEFVGMTCKHPSKNTSLSGMNMETKH
MQNYKPPSKAHHRSVHQQQEILKITVKETIQNADPFLSRSQVICFVVLGLLTCLVVLGTT
GIVFFSKCEMWLANAKYSHLLRKKKNFFLKSNNGENLSVNIIFPEKIKLTNYTK
Download sequence
Identical sequences H0ZRB6
ENSTGUP00000013159 ENSTGUP00000013159 59729.ENSTGUP00000013159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]