SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013256 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013256
Domain Number 1 Region: 3822-4003
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-35
Family Laminin G-like module 0.0026
Further Details:      
 
Domain Number 2 Region: 3126-3237
Classification Level Classification E-value
Superfamily Cadherin-like 8.51e-30
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 3336-3447
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-30
Family Cadherin 0.00062
Further Details:      
 
Domain Number 4 Region: 1137-1265
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 3230-3335
Classification Level Classification E-value
Superfamily Cadherin-like 2.49e-29
Family Cadherin 0.00092
Further Details:      
 
Domain Number 6 Region: 1555-1679
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.0009
Further Details:      
 
Domain Number 7 Region: 1030-1148
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-28
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 2281-2387
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-28
Family Cadherin 0.00082
Further Details:      
 
Domain Number 9 Region: 931-1034
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 2808-2917
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-25
Family Cadherin 0.00076
Further Details:      
 
Domain Number 11 Region: 1764-1884
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 461-579
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-25
Family Cadherin 0.0012
Further Details:      
 
Domain Number 13 Region: 3024-3132
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 14 Region: 146-270
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 15 Region: 820-921
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-24
Family Cadherin 0.00065
Further Details:      
 
Domain Number 16 Region: 1455-1559
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-24
Family Cadherin 0.00079
Further Details:      
 
Domain Number 17 Region: 2589-2727
Classification Level Classification E-value
Superfamily Cadherin-like 2e-23
Family Cadherin 0.002
Further Details:      
 
Domain Number 18 Region: 719-824
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-23
Family Cadherin 0.0011
Further Details:      
 
Domain Number 19 Region: 2919-3030
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-22
Family Cadherin 0.0026
Further Details:      
 
Domain Number 20 Region: 2491-2601
Classification Level Classification E-value
Superfamily Cadherin-like 1.05e-21
Family Cadherin 0.0031
Further Details:      
 
Domain Number 21 Region: 2073-2180
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-21
Family Cadherin 0.0016
Further Details:      
 
Domain Number 22 Region: 1667-1770
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 23 Region: 3435-3552
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 24 Region: 2389-2488
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 25 Region: 2181-2288
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 26 Region: 1243-1352
Classification Level Classification E-value
Superfamily Cadherin-like 1.04e-19
Family Cadherin 0.0031
Further Details:      
 
Domain Number 27 Region: 1872-1997
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-19
Family Cadherin 0.0026
Further Details:      
 
Domain Number 28 Region: 1981-2085
Classification Level Classification E-value
Superfamily Cadherin-like 5e-16
Family Cadherin 0.0024
Further Details:      
 
Domain Number 29 Region: 1362-1461
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000563
Family Cadherin 0.011
Further Details:      
 
Domain Number 30 Region: 572-672
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000116
Family Cadherin 0.0023
Further Details:      
 
Domain Number 31 Region: 2706-2815
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000228
Family Cadherin 0.0038
Further Details:      
 
Domain Number 32 Region: 375-473
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000243
Family Cadherin 0.0053
Further Details:      
 
Domain Number 33 Region: 3549-3638
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000414
Family Cadherin 0.0044
Further Details:      
 
Domain Number 34 Region: 4099-4136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000925
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 35 Region: 4024-4062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000295
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 36 Region: 4061-4103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.021
Further Details:      
 
Domain Number 37 Region: 42-158
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000471
Family Cadherin 0.0047
Further Details:      
 
Domain Number 38 Region: 283-363
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000814
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013256   Gene: ENSTGUG00000012873   Transcript: ENSTGUT00000013406
Sequence length 4557
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:80634098:80945407:-1 gene:ENSTGUG00000012873 transcript:ENSTGUT00000013406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVNMGRWSGSRLPPSCLALLIVKFLASICQVAHGTALLGFHFTHSTYNATVYENSAART
YVNSQTRMGITMADLSWDIKYKIVSGDDEGFFKAEEVIIADFCFLRIRTKGGNSAILNRE
IQDNYLLMVKGSVRGEDLEAWTKVNIQVLDMNDLRPLFSPTTYSVTIAESTPLRTSIAQV
TATDADIGSNGEFYYYFKGKVELFSVHPTSGVISLSGRLNYDEKNRYDLEVLAVDRGMKL
YGNNGVSSTAKLYVHIERINEHAPTISVVTHIPFPSDKEPTYAVVNVDDLDEGANGEIES
VSIVAGDPLEQFFLSKEGKWMNEYKIKERKPIDWDSFPYGYNLTLQAKDKGSPQKFSAVK
LVHIASPKKESIPLKFEKEAYDIFISEFSPPGVVVAVVKLMPEPQGVEYRISPSEEAEYF
KINPNTGLITTARSLKIIDKDLYELEVYANKGGDLKAQVTVRLEDANDHTPEFQQLSYSS
FVNESVPVGSSVLAVSAVDEDRGENGYITYSIASLNSLPFTINQFTGVISTSEELDFESS
PESYRFIVRASDWGSPYRHESEVNVTIYIGNVNDNKPLFEKVACQGVISSDFPVGGHITA
VSAIDIDELELVKYKIISGNELGLFYLSPDSGVLQLKKSLVNSGIKNNNFGLKITATDGE
NFADAMFVNISVVHGKVSSKTFSCRETRVAQKLAEKLLKKAKANVKLNLEDGFLDFYSVN
RQAPHFDKSFPADVKVSEDLPVGATILRIKAYDADSGFNGRVLYTISDGNVDSCFNIDME
MGILSVLMPLDREKTELYLLNITIYDLGNPQKSSWRLLTVTVEDANDNKPVFLQDSYSVN
ILESTSLGTEIIQVEARDKDLGSNGEVTYSVLTDTHQFAINSSTGVVYVADQLDREAKAN
YTLKIEARDRAESGHQQFSVVPLKVFLDDVNDCSPAFIPSSYNVKVLEDLPVGTVIAWLE
THDPDLGLGGQVRYSLVNDYNGRFEIDKASGAIRLNKELDYEKQQFYNLTVRAKDKGRPV
SLSSLSFVEVEVVDVNENLYTPYFPDFAVIGSVKENSRIGTSVLQVVARDEDSGRDGEIQ
YSIRDGSGLGRFSIDEETGVIYTADVLDRETTKSYWLTVYATDHGVVPLYTTMEVYIEVE
DVNDNAPLTSEPIYYPVIMENSPKDVSVIQIQAQDPDSSTNEKLTYRITSGNPQNFFVIN
PKTGLITTTSRKLDREQQAEHFLEVTVSDGGASPKQSSVWVVVQVLDENDNKPQFPEKVY
QIKLPERDRKKRGEPIYRAFAFDKDEGPNAEISYSIVDGNDDGKFFIDPKTGMVSSRKQF
TAGSYDILTIKAVDNGRPQKSSTARLHIEWIKKPVPSPVPLTFDEPFYNFTIMESDKVTE
IVGVVSVQPSNIPLWFDIVGGNYDSSFDVYKGVGTIVIAKPLDAEQRSMYNMTVEVTDGT
NIATAQVLIKVLDNNDNGPEFSQPSYDVTISEDILPDTEILQIEAIDRDEKHKLSYTIHS
SIDTVSMRKFRIDPNTGVLYTAERLDHEAQDKHILNVMVRDQEFPYRRNLARVIINVEDS
NDHSPYFTSPLYEASVFESAAVGSAVLQVTALDKDKGENAELIYTIEAGNTGNTFKIEPV
LGIITLLKEPDLTTMGQFVLSVKVTDQGSPALSATAIVRISVTMADNSHPKFTLKEYQAE
VNENVDIGTSVISLSAISQSTLVYEVKDGNVDGVFTINPYSGVITSQKALDYEHASSYQL
IVQATNMAGMASNATVNIQIVDENDNPPVFLFSEYSGSISEAAPVNSVVRSANNSPLVIR
ATDADSNQNALLVYQIVESTAKKYFTVDSSTGAIRTIANLDHETIARFHFHVHVRDSGNP
QLTAESPVEVTIEVTDVNDNPPVFSQAVFETVLLLPTYIGVEVLKVKASDPDSEIPPELT
FSIIEGNMDHFLIDSSTGVLTIKNNSLSKDHYMLIVRVSDGKFYSTAMVTIMVKEAMDSG
LHFTQNFYSTSISENSTNITKIAVVNAVGNRLNEPLKYSILNPGNKFKIKSTSGVIQTTG
IPFDREEQELYELVVEASRELDHLRVARVVVRVYIEDINDNAPVFVGLPYYAAVQVDAEP
GTLIYRVTAIDKDKGDNGEVSYLLREDYGHFEIDRGSGSITLKEAFNSDLSNIEYLVVIL
AKDGGSPSLSASIELPITIVNKAMPVFDKPFYTASVNEDVEMHVPILSINATSPEGQGII
YIIVDGDPYNQFNIDFDTGVLSVISPLDYEINSLFKLMVRASDSLTGARAEVTVDLIVND
VNDNPPVFDQSAYNATLSEASLIGTPVLQVVATDADSDNNKIVQYQIVQDTFNSTDYFHI
DSSSGLILTARMLDHELIQQCSLKVRATDNGFPPMSSEVLVSISITDMNDNPPVFNQLIY
ESYVSELAPRGHFVTCVQASDADSSDFDRLEYSILSGNDRTSFIMDSKSGVITLSNHRKQ
RMEPMYSLNVSVSDGLFTSTAQVHIQILGANLYSPVFSQSIYVAEVRENAAPGTKVIHVK
ATDGDSGVYGQISYSIINDFAKDRFLIDANGQIMTTERLDRENPLESDIDIFLRALDGGG
RTTFCTVRVIVVDENDNAPKFMAVEYRASVKADVGKGYLVTQVQAVDPDDGANSRIIYSL
YSEASVSVADLLEIDPDNGWMVTKGSFNQLKNTVLSFFVKAIDGGIPVKHSLIPVYIHVL
PPXTILPSFSQPQYSFTVAEDTLIGSTIDILHVLPNQGALYSTVNGELPENNKDGVFIIE
KDTGLIKLDKRLDHEINSAFHFKVAATIQLDKVDIVLTVDVEVKVLDVNDNKPVFEAANY
DAVIMEGMPIGTKLMQVKAVDADSSANGQVTYTLEVESELQKITEAFTIDSNSGWISTLK
DLDHEKDSAFTFAVVASDLGEALSLSSTTLVSVTVTDINDNAPVFEHEVYRGSVKESDPP
GEVVAVLSTWDEDTSDVNRQVSYHITGGNPKGKFSLGLVQNEWKVYVKRPLDREEQDIYY
LNITATDGLFVTQAAVEVTVTDVNDNNPVCEQVAYTALFPEDIPPNKVILKISAKDADIG
SNGEIRYSLYGSGNNKFFLDPENGELKSLAPLDREKIPAYNLVARATDGGGRFCQSEIHL
ILEDVNDNPPVFSSDHYTACVYENTATKALLTRVQATDPDVGVNRKVTYSLSDSADGYFS
VDRSSGIIILEHPLDRELQSSYNITVKASDQSIVLTLSSFATVTITVLDINDNPPVFERR
DYLVTVPEDTSPGTEVLSVFATSQDIGTNAEIAYLIRSGNEKGKFRINSKTGVISIIEAL
DFESCKDFYLVVEAKDGGTPALSAVTTVNVNVTDVNDNAPTFSQAVYSAVISEDAAVGDS
VVMLIAEDLDSPPNGQIHFSIVNGDQDNEFSVDPVLGLVKVKKKLDRERISGYSLVVQAR
DSGTPPLSSSVTVNVDISDVNDNSPVFTPANYTAVIQENKPVGTSILQLVVTDKDSFHNG
PPFTFTILTGNEEEEFTLDPHGVLRSAVIFKHMVSTEYVLCVQAKDSGKPQQVSHTYVQV
RVIEESIHKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDVYDVLTYTLKSEQKSLFKVN
SHDGKIIALGGLDNGKYILNVSVSDGRFQVPIDVVVHVEQLLQEMLQNTVTIRFENVSPE
DFVGLHMHGFRRTLRNAVLSQKQDSLHIISIQPVAGSSQLDMLFAVQMHSGGFYKPAYLI
QKLTNARRHLENVIRISAILEKNCSGLDCQEQHCEQSLSIDSHSLMTYSTARISFVCPRF
YRNVRCMCNGGLCPGSNDPCLEKPCPGDMQCVGYEANRRPFICQCPPGKLGECSGHTSLS
FAGNSYIKYRVSENSKKEEFKLALRLRTLQSNGIIMYTRANPCIILKIVDGKLWFQLDCG
SGPGILGISGRAVNDGSWHSVFLELNRNFTSLSLDDSYVERRKAPLYFQTLGTDSSVYFG
AQVQVDNVRSLTDKRTTQVLSGFQGCLDSVVLNNNELPLQNKRSSFAEVVGLTELKLGCV
LYPDACERHPCQNGGTCTAVPSGGYHCNCLSQFTGRNCESEITACFPNPCRNGGSCDPIG
NAFICNCKNGLTGVTCEEDINECEREECENGGSCVNIFGSFLCNCTPGYVGQYCGLRPVV
VPNIQAGHSYVGKEELIGIAVVLFVIFVLIVLFIIFRKKVFRKNYSRNNITLVQDPATAA
LLNKSNGIQFKNIRNSGDSRNIYQEVGPPQVPVRPMAYTPCFQSDSRNNLDKIVDGLGVE
HQEMTTFHPESPRILTARRGVVVCSVAPNLPAVSPCRSDCDSIRKSTWDAGTESKGVDDA
EEVTCFSGSNKGSNSEVQSLSSFQSDSGDDNAYHWDTSDWMPSARLSDIEEVPNFETADG
GSAHHGSTRELETDYYLGGYDIDSDYPPPHEEEFLSQDQLPPPLPEDYPDQYETLPPSQP
GSMASTLSPDCRRRPHFHPSQYLPPHQFPNETDTTGSQTGNEFSTFAAGPSQNTENAGAG
KMPLSLHNSLNASSSDVSAGCGFDDSEVAMSDFESMEELSLENVHIPFVETQQQTQV
Download sequence
Identical sequences H0ZRL2
ENSTGUP00000013256 59729.ENSTGUP00000013256 ENSTGUP00000013256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]