SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013346 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013346
Domain Number 1 Region: 146-733
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 2.94e-196
Family Myeloperoxidase-like 0.0000000000436
Further Details:      
 
Domain Number 2 Region: 740-798
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000334
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 788-838
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000014
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013346   Gene: ENSTGUG00000012960   Transcript: ENSTGUT00000013498
Sequence length 846
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:95280158:95316632:1 gene:ENSTGUG00000012960 transcript:ENSTGUT00000013498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFIILGFSAAIAFTAVFFSFFQIGKDIIFEQIEDNCITKAIQKGSSLVDYAARYEIKR
KIQGSGIATPALLLAFSKFPEQESQDISRAAERMEMSIQVLKQKVCQKHKRSLHPTDRLS
PDLLTMIANSSGCLPYMLPPKCPNNCLANKYRLITGACNNREHPRWGASNTALARWLPAA
YEDGLSQPRGWDPSIRYNGFQLPSVREVTRKIIHAPNEAVTEDSLYSDIIMVWGQYIDHD
IAFTPQSTSRITFLSGTECQVTCEKQNPCFPIKVTTNDTLSAGMDCLPFYRSSPACGTGD
HAILFGNISVLSTRQQINGLTSFLDASTVYGSTPAVENKLRNLTSKEGLLRVNLKYSDNH
REYLPFTDQIPSPCAQDSSASGGERVECFLAGDSRSSEVTSLTAMHTLWLREHNRLARAL
KRINSHWSAETVYQETRKIVGALHQIITLRDYIPKIIGPDAFNLYIGLYTGYNPTMNPTV
SNVFSTAAFRFGHATIQPIVRRLNAHYLDDPELPNLYLHQVFFSPWRLIKEGGLDPLIRG
LLAHPAKLQVQDQLLNEELTENLFVLSNNGSLDLSSLNLQRGRDHGLPGYNEWREFCGLP
KLETHSDLNTAITNPSVTEKIMELYHNPNNIDVWLGGLMEDFLPGARTGPLFACIIGKQM
KALRDGDRFWWENDDVFTEAQKHELKKHSLSRVICDNTGISQVPADAFQLGKFPQDFKHC
NNIPGMNLEAWQEFYQEDELCGTPKSVENGDFVYCSESGKSTVTYTCHYGFQLQGEEQLT
CTSKGWNFDAPVCTDIDECENEINPPCHPSTICINTKGSYKCLHTDPYKLAEDGRTCIGN
GCEPRV
Download sequence
Identical sequences H0ZRV2
ENSTGUP00000013346 ENSTGUP00000013346 59729.ENSTGUP00000013346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]