SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013537 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013537
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily vWA-like 1.44e-54
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 190-322
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000753
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013537
Domain Number - Region: 315-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00354
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 361-387
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.0458
Family Chicken cartilage matrix protein 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013537   Gene: ENSTGUG00000013143   Transcript: ENSTGUT00000013691
Sequence length 387
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:104311153:104320968:-1 gene:ENSTGUG00000013143 transcript:ENSTGUT00000013691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKNQPLDLVFIVDSSRSVRPEEFEKVKIFLSEMIDTLDVGERTTRVAVMNYASTVKVEFP
LRTYFDKASMKEAVSRIEPLSAGTMTGLAIQTAMEEVFTEEMGTRPAAFNIPRVVIVVTD
GRPQDQVQDVAASARTAGIEIYTVGVGRADMQALRIMASEPLDEHVFYVETYGVIEKLTS
RFRETFCAVNVCALGTHGCQQVCVSNGASHLCDCYEGYTLNPDKRTCSAVDVCAPGRHGC
GQICVSNNGSYVCDCYEGYTLNPDNKTCSALDMCAPGRHDCAQVCLSNDGSYSCGCYEGY
TLNPDKKTCSAADVCVPGRHHCQQVSGSEGARSETCDCYEGFILNSDDKTCSTITSSLVT
SEESCKCEAIAALQDSVTSHLEALSTK
Download sequence
Identical sequences H0ZSE1
ENSTGUP00000013537 ENSTGUP00000013537 59729.ENSTGUP00000013537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]