SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013655 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013655
Domain Number 1 Region: 432-696
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.86e-68
Family Eukaryotic proteases 0.000000392
Further Details:      
 
Domain Number 2 Region: 14-132
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.0000737
Further Details:      
 
Domain Number 3 Region: 182-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-27
Family Spermadhesin, CUB domain 0.0000163
Further Details:      
 
Domain Number 4 Region: 366-441
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000709
Family Complement control module/SCR domain 0.00038
Further Details:      
 
Domain Number 5 Region: 299-369
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 6 Region: 132-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013655   Gene: ENSTGUG00000013261   Transcript: ENSTGUT00000013811
Sequence length 699
Comment pep:novel chromosome:taeGut3.2.4:1:89780306:89787787:1 gene:ENSTGUG00000013261 transcript:ENSTGUT00000013811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFGVIGCSPVPRGSPFFGEIRSPSYPKPYPNDNISSWDIQVPKGYVVKLTFKYFDLEPSE
SCFYDYVKIKADKKDLGRYCGRLGSTTGNHPGRKEFVSKGNKMHLEFHSDFSNEDNGTVI
PYRGFLAYYKAVDLDECDPNNAAESNERPLCQHFCHNYVGGYFCSCRIGYQLQSDHHSCK
VECSSELFTEASGYLSSPEYPQPYPENLRCNYSIRLQNGLSISLKFLQPFEIDDHQQVHC
PYDQLKIQARGREIGEFCGREPPGVIETNSNEVDILFLTDDSGFSRGWKIHYTSEKIRCP
QPVPRDPFTIIRDLQPLYQFQDYFVVSCKTGYNLMEGDRKLVSFTAVCQADGTWHQPMPR
CEIVNCGIPKNLTNGVFSYVKEPANNEYQSVISYQCNEPYYHIVTGTGGERFTCSPEGTW
LDQDGQKRIPSCLPVCGKPVHPVVEVQRILGGKSAGRGNFPWQALTGINGRGGGALLGDR
WILTAAHTIFPKGGVRNNVSLEQLAEEAEIFLGHTNVDELRRMGTHPVRRIFIHPDFNPK
DEHNFNGDIALLELKNPVTLGPTLLPICLPDATNTSFYAHGHMGYVSGFGVDKNRISSDL
KYVSLPAVSQEKCQSWLDSNKKGIPMVFSENMFCAGLLEGKKDTCQGDSGSVFTVLDRES
GRWVATGIVSWGIGCATGYGFYTKILNYVDWINGIVKED
Download sequence
Identical sequences H0ZSQ9
ENSTGUP00000013655 59729.ENSTGUP00000013655 ENSTGUP00000013655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]