SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013660 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013660
Domain Number 1 Region: 427-679
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-67
Family Eukaryotic proteases 0.0000013
Further Details:      
 
Domain Number 2 Region: 17-129
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-32
Family Spermadhesin, CUB domain 0.00000534
Further Details:      
 
Domain Number 3 Region: 173-287
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-26
Family Spermadhesin, CUB domain 0.000074
Further Details:      
 
Domain Number 4 Region: 358-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000167
Family Complement control module/SCR domain 0.00036
Further Details:      
 
Domain Number 5 Region: 297-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000556
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 126-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000639
Family EGF-type module 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013660   Gene: ENSTGUG00000013265   Transcript: ENSTGUT00000013816
Sequence length 682
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:89790033:89797015:-1 gene:ENSTGUG00000013265 transcript:ENSTGUT00000013816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSLIFFCLPIWADAASMYGEILSPNYPQVYPNYANETWQIQVPVGYGIHLYFTHLDLEP
SQDCEYDFVEILSGGYVEGVLCGQKKPRAPGSWIVEEFRVPYNTLTMIFQSDFSNEERFT
GFAAYYIAVDLDECMDFVDEPCSHYCNNYIGGYFCSCPPDYFLYNDNKTCGVNCSGNVFT
EPSGEIASPNYPNQYPENSRCDYRVALSPGYSVVLTIRSDDFDVEPADSKGTCHDSLTIV
AGKQHFGPYCGSKFPGPSEIRTRSNILDIIFQTDQGTQHRGWKIRYYGDPVTCPMSVISN
SVLDPKKDRYILKDTVKVTCVEGYEIVRQRDSITSFVSSCQENGEWSNSHLSCVPVNCGD
PPPVDNAQASYVSELQEPLYTAAVRYQCEAPYYTLENKGHVIYRCSASGEWVNEKMGTKL
PKCVPVCGVPSNPIRDTGRIFGGTRAEKGNFPWQVYFSDPRASGVLISDRWVMTAAHVLD
GYDKPPIYAGVINVRREFLKSEAENLIPEASFIHPGWKEEPAEPRIDFDNDIALLKLKEP
VKMGPNISPICLPGKSPEYELEEGTLGYIAGWGRREKGRLPADLWKAQIPVVNMDKCRSV
KPEGFDDSVTYIFTDNMICAGGGKDSCQGDSGGAYAIQDPLNATRYYVAGLISWGPKCGT
FGLYTKVVRYLDWIRETMREHE
Download sequence
Identical sequences H0ZSR4
ENSTGUP00000013660 59729.ENSTGUP00000013660 ENSTGUP00000013660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]