SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000013892 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000013892
Domain Number 1 Region: 237-426
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-40
Family Laminin G-like module 0.00000436
Further Details:      
 
Domain Number 2 Region: 440-635
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.04e-25
Family Laminin G-like module 0.0000564
Further Details:      
 
Domain Number 3 Region: 15-67
Classification Level Classification E-value
Superfamily GLA-domain 4.54e-20
Family GLA-domain 0.00045
Further Details:      
 
Domain Number 4 Region: 93-218
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000013892
Domain Number - Region: 212-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000489
Family EGF-type module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000013892   Gene: ENSTGUG00000013492   Transcript: ENSTGUT00000014051
Sequence length 638
Comment pep:novel chromosome:taeGut3.2.4:1:100769939:100785410:-1 gene:ENSTGUG00000013492 transcript:ENSTGUT00000014051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSQQYASQFLLRKRRANSFMEESKKGNLERECIEELCNREEAREIFENNPETEYFYPKYL
GCLASHRAGVFRVAAVTPDSPADLRACVKEISNQCSPLPCHKDGYKDCIDGQAKYTCVCK
AGWRGENCEEDINECEDFNGGCSQRCSNFPGSFRCLCEDGYFMHSNKRDCGDINECVLHP
NICGTAICKNTQGKYECQCPEGYMYNSTSKNCEDIDECAENICAQLCVNSPGSYSCYCDG
KKGFKLSKDMKNCESVTECIHLNLEKNYQLLYLAEQFTGAPVLHLKFKLPNVTRFTAEFD
FRTYDAEGLILYAESLDNSAWILLALRDGKIEIQFKNEFGTKVTSGGKAINDGLWHIVSV
EELEHSISVKIAKEAVMSINSPGTLFKQSQGFLETKVYIAGLPRRVGGALVKQINPRLDG
CIRAWNLMNQGHSGVNEVIQEKESKHCFVEVERGSFYPGTGMAAFQINYNNLDSAEDWLI
NVTLTIRPSTDTGVMFALVSNETVPLALSIVGSNSSDSQKITVTIGNIIVAQLESKKLCT
PKKVQVGLLVTKQELELAVDSHTDRSNSEQLSTLHQAMMANVVTYLGGLPDVPLGATPVT
AFYNGCMEVKVNSRQLDLDEAISKHNDIRSHSCPRIMQ
Download sequence
Identical sequences H0ZTE6
ENSTGUP00000013892 ENSTGUP00000013892 59729.ENSTGUP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]