SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014137 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014137
Domain Number 1 Region: 19-219
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-23
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 2 Region: 405-446
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000709
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 247-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000123
Family EGF-type module 0.009
Further Details:      
 
Domain Number 4 Region: 310-441
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000392
Family Growth factor receptor domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014137
Domain Number - Region: 33-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0178
Family EGF-type module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014137   Gene: ENSTGUG00000013734   Transcript: ENSTGUT00000014302
Sequence length 484
Comment pep:novel chromosome:taeGut3.2.4:Un:171814091:171820996:-1 gene:ENSTGUG00000013734 transcript:ENSTGUT00000014302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSSPCPNGGVCYSIWDDFTCTCPPNTVGKACEEVKWCELGPCPHEAQCKLVHQGFECLAN
AVFSGRSSAIFYRSNGKISRDLTNIVFGFRTRDTDVILYAEREPEFVIISIHNSKLLFQL
QSGNSFYRLTLASSVPVSDGKWHRVMVSMVEPLSQSSRWYMDIDSKRDTATSTAAAGSLN
FLREETDIYVADKAFDSLDGLRGCMSTIEISGIYLSYFENADIPTKKPQEEQFLKISANP
ALTGCLEVDFCSSDPCMHGGICEDFYTSYRCVCPDGWTGTYCEVNIDECSSNPCIHGNCT
DGIASYECSCEPGYTGENCEEDIDDCHGHQCVNGATCVDGINGYSCLCAANFTGRFCRYR
RLPYTVCGNEERNLTCFNYGNCTDLGGELSCTCLPGFVGERCEKDIDECSSDPCLNGGLC
QNLLNKFHCLCDVNFAGDRCEIDVSDLSFFVSLLLWQNLFQLLSYLILRMDDEPAVEWGD
QEDY
Download sequence
Identical sequences H0ZU40
ENSTGUP00000014137 ENSTGUP00000014137 59729.ENSTGUP00000014137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]