SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014606 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014606
Domain Number 1 Region: 40-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 2 Region: 110-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000014606
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00363
Family Laminin-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014606   Gene: ENSTGUG00000014222   Transcript: ENSTGUT00000014800
Sequence length 153
Comment pep:novel chromosome:taeGut3.2.4:Un:32896343:32898416:1 gene:ENSTGUG00000014222 transcript:ENSTGUT00000014800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLQCDCTPHCGGSCDRCCPGYNQFPWKPATADSANECQPCNCNGHAYDCYYDPEVDRHKA
SRSREDKFEGGGVCIDCQHHTTGINCERCIPGYYRSPDHPIDSPYVCYRCNCESDFTDGT
CEDLTGRCYCKPNFTGEHCQACAEGYLNFPHCY
Download sequence
Identical sequences H0ZVF9
ENSTGUP00000014606 59729.ENSTGUP00000014606 ENSTGUP00000014606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]