SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000014639 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000014639
Domain Number 1 Region: 13-80
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.66e-21
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 2 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000819
Family EGF-type module 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000014639   Gene: ENSTGUG00000014257   Transcript: ENSTGUT00000014836
Sequence length 134
Comment pep:known_by_projection chromosome:taeGut3.2.4:10_random:256639:259001:-1 gene:ENSTGUG00000014257 transcript:ENSTGUT00000014836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQCPSGMTLDASGRTCLDIRLESCYLQHEDEQCTSQIPGRHRMDACCCSVGAAWGHECEE
CPLRGTPEFEALCPRGPGFSTKIEISGKPFSKDINECKMFPSLCTHGKCRNTIGSFKCRC
DSGFALDSEERNCT
Download sequence
Identical sequences H0ZVJ2
59729.ENSTGUP00000014639 ENSTGUP00000014639 ENSTGUP00000014639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]