SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015603 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015603
Domain Number 1 Region: 152-265
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-38
Family Spermadhesin, CUB domain 0.00016
Further Details:      
 
Domain Number 2 Region: 10-104
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-33
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 3 Region: 288-347
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-18
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 4 Region: 105-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000439
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015603   Gene: ENSTGUG00000015249   Transcript: ENSTGUT00000015870
Sequence length 348
Comment pep:known_by_projection chromosome:taeGut3.2.4:Un:12615222:12618513:1 gene:ENSTGUG00000015249 transcript:ENSTGUT00000015870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AICGGDVKKDNGPIQSPNYPDDYRPSKVCVWKITVSEGYHVGLTFQSFEIERHDSCAYDY
LEIRDGSSDSSSLIGRYCGYDKDDIKSTSNKLWMKFVSDGSINKRQLFKDKDECSKNNGC
QHECLNSFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSISGTITSPNWPDKYPSKKECT
WAISTTPGHRIKLVFSELDVEAQQECTYDHLEIFDGKDAKAPALGRFCGAKEPEPIVSSG
NKMFLKFVSDNSIQKKGFEATHTTVCGGQVRAEVKTKDLYSHAQFGDNNYPGGSDCEWVI
MAEEGFGVELIFQTFEIEEEADCGYDYMELFDGYDGTAPRLGRFCGSG
Download sequence
Identical sequences H0ZYA1
ENSTGUP00000015603 ENSTGUP00000015603 59729.ENSTGUP00000015603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]