SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000015651 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000015651
Domain Number 1 Region: 41-167
Classification Level Classification E-value
Superfamily dUTPase-like 1.96e-25
Family dUTPase-like 0.00046
Further Details:      
 
Domain Number 2 Region: 160-231
Classification Level Classification E-value
Superfamily Acid proteases 0.000000000000668
Family Retroviral protease (retropepsin) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000015651   Gene: ENSTGUG00000015308   Transcript: ENSTGUT00000015918
Sequence length 236
Comment pep:novel chromosome:taeGut3.2.4:Un:41445760:41447366:1 gene:ENSTGUG00000015308 transcript:ENSTGUT00000015918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRQTVAQFGPKSEPAKQMIDYIFDTMLLIPNDMRGIVKWSGTLQPATAGSLGLDLAATV
NVTLMTTRPEKIPTGIKGPLKINGQKYGALVLGRSSVTIMGLFILPGVIDADYTGEIQVM
AHTPFPPLSIKKGQRIEQLIPLPQMTKGISPRNNQQRGDKGFGSSGIVMLSVDLNTRPKK
TIQITYDNQSITLSGLLDTGADTSIISPDNWPAHWPQRATTDMVTGVGGFTLARKT
Download sequence
Identical sequences H0ZYE8
59729.ENSTGUP00000015651 ENSTGUP00000015651 ENSTGUP00000015651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]