SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016674 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016674
Domain Number 1 Region: 42-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000148
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 2 Region: 4-44
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.062
Further Details:      
 
Domain Number 3 Region: 165-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 122-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000586
Family Laminin-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016674   Gene: ENSTGUG00000016375   Transcript: ENSTGUT00000017017
Sequence length 217
Comment pep:novel chromosome:taeGut3.2.4:Un:48139031:48141313:1 gene:ENSTGUG00000016375 transcript:ENSTGUT00000017017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHGHCMCRHNTKGLNCEQCLDFYHDLPWRPAEGRNSNACKKCNCNGHSSQCHFDMAVYMT
TGNTSGGVCDDCQHNTMGRNCEQCKPFYFQHPERDLRDPDVCEPCNCDPAGSQNGGICDR
YTDFSTGLIAGQCRCKLFVEGERCDLCKEGFYGLSADDPVGCQSCACNPLGTHPGGNPCD
SETGNCYCKRLVTGKQCNQLLPEHWGLSNDMDGCRPC
Download sequence
Identical sequences H1A1B2
ENSTGUP00000016674 ENSTGUP00000016674 59729.ENSTGUP00000016674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]