SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000016861 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000016861
Domain Number 1 Region: 85-225
Classification Level Classification E-value
Superfamily EF-hand 1.18e-49
Family Osteonectin 0.00000209
Further Details:      
 
Domain Number 2 Region: 31-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000402
Family Ovomucoid domain III-like 0.00081
Further Details:      
 
Domain Number 3 Region: 3-27
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family Follistatin (FS) module N-terminal domain, FS-N 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000016861   Gene: ENSTGUG00000016552   Transcript: ENSTGUT00000017211
Sequence length 226
Comment pep:novel chromosome:taeGut3.2.4:Un:135987653:135991021:-1 gene:ENSTGUG00000016552 transcript:ENSTGUT00000017211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPDTCHNFHCKRGKVCHADKQGEPHCICQDPAACPPTEDYEHVCGTDNKTYDGTCQLFGT
KCQLEGTKTGRQLHLDYMGSCKHIPCTDYEVDQFPLRMRDWLKNILIQYYERDLNTSGIL
TEKQRNKVKTIYQNDKRLVAGDHPVELLLHDFEKNYHMYVYPVHWQFHQLDHHPVDRLLT
HSELAPLRASLVPMEHCITRFFQECDGDQDKLIALKEWCHCFGIKE
Download sequence
Identical sequences H1A1U9
ENSTGUP00000016861 ENSTGUP00000016861 59729.ENSTGUP00000016861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]