SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017519 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017519
Domain Number 1 Region: 1807-2053
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.27e-53
Family Ankyrin repeat 0.0000000566
Further Details:      
 
Domain Number 2 Region: 388-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000785
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 836-967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000121
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 950-1081
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 570-701
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000659
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 6 Region: 1072-1205
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000691
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 508-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 8 Region: 184-319
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000314
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 9 Region: 733-775
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000491
Family EGF-type module 0.0031
Further Details:      
 
Domain Number 10 Region: 1201-1253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000136
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 11 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000205
Family EGF-type module 0.02
Further Details:      
 
Domain Number 12 Region: 42-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000336
Family EGF-type module 0.014
Further Details:      
 
Domain Number 13 Region: 1284-1326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000347
Family EGF-type module 0.016
Further Details:      
 
Domain Number 14 Region: 811-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.017
Further Details:      
 
Domain Number 15 Region: 1411-1443
Classification Level Classification E-value
Superfamily Notch domain 0.000000157
Family Notch domain 0.0014
Further Details:      
 
Domain Number 16 Region: 311-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.019
Further Details:      
 
Domain Number 17 Region: 1243-1286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000357
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 18 Region: 1490-1521
Classification Level Classification E-value
Superfamily Notch domain 0.000000379
Family Notch domain 0.0034
Further Details:      
 
Domain Number 19 Region: 86-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000004
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 353-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000589
Family EGF-type module 0.022
Further Details:      
 
Domain Number 21 Region: 692-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000114
Family EGF-type module 0.045
Further Details:      
 
Domain Number 22 Region: 1364-1403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000132
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000017519
Domain Number - Region: 4-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 1453-1484
Classification Level Classification E-value
Superfamily Notch domain 0.000772
Family Notch domain 0.01
Further Details:      
 
Domain Number - Region: 1326-1362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00877
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017519   Gene: ENSTGUG00000017231   Transcript: ENSTGUT00000017918
Sequence length 2442
Comment pep:known_by_projection chromosome:taeGut3.2.4:8_random:1062441:1137848:1 gene:ENSTGUG00000017231 transcript:ENSTGUT00000017918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALQCMDDSKPCVNEGKCIPYQNGTGYCKCREGFLGDYCQYRNPCESNTCKNGGTCEAASL
IGKPTCKCAPGFTGEECQYSESHLCYVSQPCLNGGTCHPHGQDTYECVCLPGFTGKECQW
IDACTSQPCANGSTCTVSGNKFSCTCPAGYTGQRCEMDVNECATPGLCQHGGTCVNLPGS
YRCQCRLGYTGHRCESPYVPCSPSPCMNGGTCHQTSDFTFECNCLPGFEGSVCGHNVDDC
PNHKCLNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECQLQPNACQNGGTCTNHNGGYAC
VCVNGWSGDDCSKNIDDCFTASCANGSTCIDRVASFSCICPEGKAGLLCHLDDACVSNPC
QKGALCDTNPVNGNYICTCPQGHKGADCTEDVDECAMANSNPCEHAGKCVNTEGSFHCEC
LKGYTGPRCEMDINECHSNPCQNDATCLDKIGGFTCLCMPGFKGVHCEQDIDECLSNPCV
NNGVCLDKVNRFLCVCPPGFSGAVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTG
LLCEENINNCDPDPCHHGECQDGIDSYTCICNPGYMGAICSEQIDECHSNPCLHQGRCID
LVNGYQCNCLLGTSGVNCENNFDDCASNPCIHGDCIDGINRYNCACKPGFTGPRCNADID
ECTSSPCHNGGTCINEVNGFRCVCPEGFHHPHCQSQADGCLSNPCVHGNCTHIATGYKCV
CDPGWIGDYCSTEGNECKSNPCQNGGTCEDLLNGYRCACRKGFKGENSEKNYGNCIGSSC
CRHDTCCPLHSTFFCFSLFCSPGVNCQVVVSPCSPNPCENSGICQESPDSEGYTCQCAPG
WEGERCTVDIDECLSKPCKNHALCHNIQGSYLCECRPGFTGGDCDSNIDDCLSNPCQNGA
SCVDGIDSFSCICLPGFHGDKCQTDTNECLSEPCRNGGTCTHYVNSYTCKCPPGFQGTNC
ESNIDECTDSSCFNGGTCVDGINSFTCQCPLGFTGPFCLTEINECDSHPCLNRGTCVDSL
GTYRCICPLGYTGKNCKSLVDLCSKSPCKNRGTCVQTLAQTRCVCPPGWTGAYCDVPNVS
CQVAASQRGVPVDQLCQHSGHCLNVGNTHHCQCQVGYTGSYCEVQLDECDSSPCQNGATC
RDHLGGYQCECVAGYQGVNCEYEVDECQFQPCQNGGTCIDLVNHFKCSCPPGTRGRFCEE
NVDDCTSESGAPRCFNGGQCIDQIGGYSCLCPQGFAGERCEGDINECLSNPCNPRGSLDC
VQLTNDYRCICRSAFTGRHCESVIDVCPRRPCQNGGTCAVASNMPDGFICQCPPGYSGAK
CEFSSHSTCGQVKCKKGEQCIQTSSGPRCYCPKLSVGEECQTHPGCASAPCQNGGSCHPH
SQPPYYYCQCPVHTQGSHCEQPVTFSPEPRRCLHSQCAEKARDGYCDEDCNTHACQWDGG
DCSLTVEDPWANCSSSLPCWMLFNGQCDEFCNTPECLFDNFECQQNSRTCKYDKYCADHY
ADGRCDQGCNSEECGWDGLDCAGDKAEKLAEGTLIIVVLMPPDELLGDVRSFLRTLGTLL
HTNLRIKLDSQGNPMVFPYYGEKSAARSRRSLVVVRKHRELEQEVIGTKVFLEIDNRQCA
EDSEQCFHNTEAAAALLAAQAIKGMLPYPFVSVQSEPLLPPKTQLLYLLAVAALIILLIL
LLGVMMAKRKRKHGSLWLPEGFILRRDPSNHKRREPVGEDAVGLKNLSVQIPEGNLADPG
TTEHWAGDGGPQPKRAKAEDQALLPEGDEQIDQRQWTQQHLEAADVCGSTSLALTPPQAD
QEVDVLDVNVRGPDGCTPLMLASLRAGGSDISEDDEDGEDSSANIITDLIYQGANLQAQT
DRTGEMALHLAARYSRADAAKRLLDAGADANARDNMGRTPLHAAVAADAQGVFQILIRNR
VTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEAT
LVLLKNGANRDMQDNKEETPLFLAAREGSFEAAKILLDHFANRDITDHMDRLPRDVAQDR
MHHDIVQLLNEYNVAHSPAGHPGAMLNSALSPVICGPNRSFLNLKHASLSKKSRKPNAKG
MPTSLTKDAKRRRKKSLSEGKGQFSESSVTLSPVDSLESPHAFVSEPTSSPVMPSPGVLH
SSPSSLLTAPSVQAAHTMSFSNLHEMQPLGRGSSTVLPSVSQLLSQHRTTPPNSGLGRLR
PGNVSTEWMNRMEVNESQYNEMFGMVPQVMHSHPSVSQQSGLVQADAKHLGVSRESLPPI
MTFQLVPKGSISQQALPQQAQSNCAQNMAGPLSSMYQIPDLAQLPSASFSMAAIPQQDGQ
VAQTVLPAYHQFQSSMGKYPTPPSQHSCYSSATERTPSHNRHLQGEHPYLTPSPESPDQW
SSSSPHSASDWSDVATSPSNNQRGPAAAHMTEQQRNNMQVYA
Download sequence
Identical sequences H1A3Q6
59729.ENSTGUP00000017519 ENSTGUP00000017519 ENSTGUP00000017519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]