SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017872 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000017872
Domain Number 1 Region: 3-39
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017872   Gene: ENSTGUG00000018165   Transcript: ENSTGUT00000019122
Sequence length 51
Comment pep:novel chromosome:taeGut3.2.4:7:34161442:34223698:-1 gene:ENSTGUG00000018165 transcript:ENSTGUT00000019122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVCNPVCLNGGVCVRPNTCSCPSGFYGPQCQRECQKCPRKKGSLPDCSVQT
Download sequence
Identical sequences H1A4Q6
ENSTGUP00000017872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]