SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000000998 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000000998
Domain Number 1 Region: 2245-2317
Classification Level Classification E-value
Superfamily TB module/8-cys domain 5.36e-19
Family TB module/8-cys domain 0.00053
Further Details:      
 
Domain Number 2 Region: 1963-2034
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.45e-18
Family TB module/8-cys domain 0.0000882
Further Details:      
 
Domain Number 3 Region: 966-1100
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.98e-18
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 890-957
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.2e-17
Family TB module/8-cys domain 0.00066
Further Details:      
 
Domain Number 5 Region: 1681-1814
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.36e-17
Family Growth factor receptor domain 0.0063
Further Details:      
 
Domain Number 6 Region: 2041-2175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.49e-17
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 475-600
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-17
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 8 Region: 387-518
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 9 Region: 120-205
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.01e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 10 Region: 786-870
Classification Level Classification E-value
Superfamily TB module/8-cys domain 6.67e-16
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 11 Region: 594-664
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000144
Family TB module/8-cys domain 0.00078
Further Details:      
 
Domain Number 12 Region: 1329-1454
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000863
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 13 Region: 2404-2523
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000204
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 14 Region: 2359-2413
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000685
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 15 Region: 707-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000251
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 16 Region: 162-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.0095
Further Details:      
 
Domain Number 17 Region: 1093-1143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000019
Family EGF-type module 0.0069
Further Details:      
 
Domain Number 18 Region: 2201-2250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000293
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 19 Region: 1136-1178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 2319-2366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000559
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 21 Region: 1927-1968
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000839
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 22 Region: 1290-1342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000746
Family EGF-type module 0.028
Further Details:      
 
Domain Number 23 Region: 1249-1302
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000163
Family EGF-type module 0.017
Further Details:      
 
Domain Number 24 Region: 1807-1856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000326
Family EGF-type module 0.0058
Further Details:      
 
Domain Number 25 Region: 1565-1610
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 26 Region: 1843-1888
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000128
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 27 Region: 749-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.01
Further Details:      
 
Domain Number 28 Region: 2164-2206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000599
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000000998
Domain Number - Region: 91-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00146
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000000998   Gene: ENSTGUG00000000946   Transcript: ENSTGUT00000001010
Sequence length 2525
Comment pep:known_by_projection chromosome:taeGut3.2.4:28:4392476:4451091:-1 gene:ENSTGUG00000000946 transcript:ENSTGUT00000001010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCGDGFCSRPNMCTCSNGQLSPNCGSAG
EHGADVPIQGGGDTPSSASTLEGLSRSRTVCENGCHNGGRCIGPNRCACVYGFTGPHCER
DYRTGPCFSQVNNQMCQGQLSGIVCTKTMCCATIGRAWGHPCEMCPAQPHPCRRGFIPNI
RTGACQDVDECQAIPGLCQGGNCINTVGSYECKCPAGHKQSETSHRCEDVDECGAIPGVC
DGGDCTNTVGSYVCSCPRGFVSSPDGSRCLGEGETAFGGAGIGGKCSFLPVLAAPSCARL
DCLGLPPSLEFGLWKGLARMRRRRISCSPLMGIVIGISSWGHPGAPQPCLCPPGTATIPS
PGTSQGSPALPVPGTSRGSPAPPRTATLNQTIDICKHFTNLCLNGRCIPTPSSYRCECNM
GYKQDVRGECIDVDECSSSPCVHGDCVNTPGSYHCKCHEGFQSTPTKQACIDIDECIMNG
VMCRNGRCVNTDGSFQCICNAGFEITPDGKNCVDHDECATTNMCLNGMCINEDGSFKCIC
KPGFVLAPNGRYCVDIDECETPGICMNGWCINTEGSFRCECLGGLAIGVDGRVCVDTHMR
STCYWGIKKGTCARPFPGAVTKSECCCANPDHGFGEPCQPCPAKNSAEFQALCSSGIGIT
ADGRGGSQCQLGSAWISRESTEQPGSHGLAKPSRGKEPEAKPRPCSDVDECSVNRLLCDN
GLCRNTPGSYTCTCPKGFVFRTETDTCEDINECTSNPCVNGLCRNNAGSFACECSPGSKL
DPSGTICVDSMKGTCWLNIQDGRCEVNINGATLKSECCATLGAAWGSPCERCEIDTACPR
GYARMKGVTCEDVNECEVFPGVCPNGRCVNSAGSFRCECPEGLTLDGTARTCVDVRVEQC
YMRWDEDECTEPLPGKFRMDMCCCSVGSAWGSDCECPRAGSAEFKALCPRGPGFANRGDV
LSGRPFYKDVNECKVFSGLCTHGTCRNTIGSFRCICGNGFALDAEERNCTDIDECRISPD
LCGHGSCVNTPGSFECECFEGYESGFMMMKNCMDINECERDPLLCRGGICMNTDGSFECI
CPPGHELTAEGNTCIDINECSLSDNLCRNGRCVNVIGTYQCSCDSGFQATPDRQGCVDID
ECTITNGGCDTHCSNSEGSYECSCSEGYALMPDKRSCAGAAPGTSVSPTHDEGVSFLSPF
QRKDFSGWMILLSTATSGSPNPAAGSPQAQPGCAGGAELCQPWCPSSADIDECEIGAHNC
DMHASCINIPGSFKCKCRSGWLGDGLKCNDLDECATEEHKCNLNANCVNTPGSYRCACRD
GFNGDGFSCSDVDECADNVNLCENGQCLNAPGGYRCECEMGFNPTEDSKACQDIDECTFQ
NICVFGTCQNLPGMFRCACDDGYELDRSGGNCTDINECADPVNCINGLCVNTPGSYLCNC
PQDFELNPTGVGCVGEWHLPPTPTLGVLVGPVKLDLDAIRVCDPLGTQGWLPLCVTRTTV
RARAVWASQLPQEWLGASLPLSFPDSLITNLSPAWSLCQTHPSLMPSLTPPLPVPFSACA
RCSDSFTDIDECSAHIGICGPGTCYNTLGNYTCVCPPEYMQVNGGNNCMDMRKSVCYRIF
NDTCENELTFPLCKVGMVMLRSIPGMLRSIPGMSGAFPGCQGGMLMLRSIPGMPGWDADA
GDADIDECSEIPAICTNGVCINQIGSFRCECPIGFSYNNILLICEDIDECSSGETLCQRH
AECVNIPGSFRCECATGYRLSPGGACVGRNECQEIPNVCSHGDCVDTEGSYVCICHNGFK
ATGEQTMCMDIDECDRQPCGNGTCKNTVGSYNCLCFPGFELTHNNDCMDVDECSSLVGQV
CRGQCINSVGSFQCLCQEGYDRPTGKNCISKTKYALRSMGSPSRKFRGKRGRVSPPPSPV
LMTPGYINECEEEPNICLFGTCTNTPGSFQCVCPPGFVLSDNGRRCFDTRQSFCFTRFDN
GKCSVPKAFNTTKARCCCSKMPGEGWGDPCELCPQEGNVAFQELCPYGHGAIPGPGDTRE
DVNECSENLGVCINGACINTDGSFRCECPFGYNLDYTGVNCVDTDECSIGNPCGNGTCTN
VVGGFECACDEGFEPGPMMTCEDINECSLNPLLCAFRCINTFGSYECTCPSGYALREDRR
MCRDLDECAEGLHDCESRGMLCKNLIGTFMCICPPGMQRRPDGEGCTDENECRTKPGICA
NGRCVNTAGSYRCDCNEGFQVSPSGTECIDTRQGFCFTEVLQTMCQMSSTNRNLVTKSEC
CCNSGRSWGPQCELCPLPGTAHYKKMCPHGPGYSTDGRDIDECKVLPNLCRNGQCINSIG
SFRCHCRLGYTPDITGTACQDLDECNQSPKPCNFICKNTEGSYQCSCPRGYILQEDGKIC
KDLDECSTKQHNCQFLCVNVIGGFNCKCPPGFTQHHSSCIDNNECTAQPSLCGAKGQCLN
TPGSYNCECQKGFSLDSSGVNCEDVDECDGNHRCQHGCQNVLGGYRCGCPQGYVQHYQWN
QCVGE
Download sequence
Identical sequences H0YRT9
59729.ENSTGUP00000000998 ENSTGUP00000000998 ENSTGUP00000000998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]