SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000001874 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000001874
Domain Number 1 Region: 429-816
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.47e-131
Family Ankyrin repeat 0.000000000313
Further Details:      
 
Domain Number 2 Region: 186-444
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.08e-72
Family Ankyrin repeat 0.00000289
Further Details:      
 
Domain Number 3 Region: 34-257
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-55
Family Ankyrin repeat 0.0000152
Further Details:      
 
Domain Number 4 Region: 3336-3453
Classification Level Classification E-value
Superfamily DEATH domain 2.79e-28
Family DEATH domain, DD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000001874   Gene: ENSTGUG00000001807   Transcript: ENSTGUT00000001892
Sequence length 3722
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:2797609:2987862:1 gene:ENSTGUG00000001807 transcript:ENSTGUT00000001892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEAAQKSDGGEKCNGGSQRRKRPKKSDSNASFLRAARAGNLDKVVEYLKSGIDINTCN
QNGLNALHLAAKEGHVGLVQELLERGSAVDSATKKGNTALHIASLAGQAEVVKVLVKEGA
NINAQSQNGFTPLYMAAQENHIEVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAI
LLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKISVTRASGFTPLHIAAHY
GNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPL
HCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTL
DYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGAS
IQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCL
LRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQL
DVASVLLEAGASHSMSTKKGFTPLHVAAKYGSLEVAKLLLQRRACPDSAGKNGLTPLHVA
AHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIATTLLNYGAETNILTKQGV
TPLHLAAQEGHTDMVTLLLEKGSNIHVATKAGLTSLHLAAQEDKVNVAEILAKHGANQDA
QTKLGYTPLIVACHYGNIKMVNFLLKHGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH
GAKPNAITTNGNTALAIARRLGYISVVDTLKVVTEEITTTTTTVTEKHKLNVPETMTEVL
DVSDEEGDDTMTGDGGEYLRPEDLRELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFS
SDRSHTLSHASYLRDSAMIDDTMVIPSQQVTTLAKEAERNSYRLSLGPEILDNVALSSSP
IHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEG
EGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVILRSENGDSWKEHFCEYTEDE
LNEILNGMDEVLDTPEELEKKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVV
PQVQAVFPEGALTKRIRVGLQAQPMHTELTKKILGNKATFSPIVTLEPRRRKFHKPITMT
IPVPKASSDGLMNGYGGDTPTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVS
ARFWLIDCRQTQESVTFASQVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDK
TLEQQENFAEVARSRDVEVLEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVK
VRDSTQEPCGRLSFMKEPKSTRGLVHQAICNLNITLPIYTKESDSDPEPEEVMSLNQHRN
DETESTETSVLKSHLVNEVPVLASPDLLSEVSEMKQDLIKMTAILTSDPSDKSGSIKVKD
LEKSAEEEPGEPFEIVERVKEDLEKVNEILRGGSYTREEHGLQKSLSRQEPLEEEWIIVS
DEEIEEARRNAPSEVTEPSHVEVRVDKGTTKKGEQDMTGVVDYLAEDLKTHTSLHEGKPQ
ALQEEVVEEKFKPVVVSRDSEKKGKESPKTGKPSSQEQQKAASEVKKPLRAKLREKPKPK
EGKVHSSGEKLRLPKLTAEEAPAGEPGLKVTGAPEPKAVSPVIEETPIGSIKDKVKALQK
RVEDEQKVRSKLPVRVQAKEGPAEKAPKKPVQVKKPVAHKAQPPVSPSSKTERLEETMSV
RELMKAFQSGQDPSKNISGLFEHKSVKQKQQAPEKETPRKKTIPLQSEAKRTSNLKTDKQ
KEKPSMVSKAEKEPQSKKGKTQIPTIETAKKGSGKDQGKEQSSKKPTQPLPPVMTAESAK
EMAAGKGRTSDDQGDLDFQISPDRKTSTDFSDVIKEELEDNDKYKQFRHLSVTEAGEVNL
EQVLTSPFGAAFPTEYGKDGFLPALSLQSAALDGSSESLKHEGVADSPGSLLDGTPQISS
EESYKHEGLAETPETSPESLSFSPKKTDGQIEDAKGAPQVHTTAETRSTKELSSKADEKG
ITERQLDAVTETSESHSDHLSEEHVPPASEEEADKLKESSSASIVKDTSRDKESRTTAHF
TKSSETHDTALEKEKDVACERRFTVRSPQKLELSLASHDSEGFSPVADDSLTISHKDSLE
ASPVLEDNSSHKTPDSLEPSPMKESPCRDSLESSPVEPTVKACILGQGPLPSVHSKAEAC
PELASVRSRILRDPEGSADDDSLEQTSLVESSGKSPVSPETPSSEEISYEITPKMADIPK
SATIPEVNEEPEDDSESEPKKRFTPEEEMFKMVTKIKMFDELEQEAKQKRDYKRSCKQDE
SSVVANSEASREAEASEPTAVVEKGIPTLITPAAESRKSSSSSESEPELTRLKKEADSGL
LMEPVIRVQSPSPLPSSMDSSSSPDEAGFQPIDSQPCSVRIGEVKAQGKGDKEELLILGH
SCKPSMGTCPSDGCESAEGAESKCCDGTGDCEMVSPDASVTRSGCTPCHSVGDGSQKEVD
AESSLTMGQCDATEKGVKPAALDLISTGAVSEEADGLSHGHSTTKYSVPCDSKLAEGDTT
AHFASARDLGKADTGCETSHRAARTEEPLPEYSSLTTDTGELNSCAADADDGSAPYVVSP
YENVSSGHFFIDSESEVGSGRSLLSRETYSVAEGKDQTGEALLSRDMGSDYCSSEEVYME
MEPKPEDGFQTISQGSPTSDSTKLSESALEDIGDETEKLVSQVVITRTDVDSDMWSEIRE
DDEAFEARVKEEEQKIFGLMVDRRSQGTTPDTTPARTPTEEGTPLSEQNPFLFQEGKLFE
MTRSGAIDMTKRNYPDESFHFFQVGQEPQEEVSLCEEVKEVAEAESSKLKGSVDPFAPSE
SEESDIQEQDALKHSPPSPESEEMMDLKSRIPIKMGISASSKSPKKEIAASEAEPLSRME
TDTVDSSQVPCPISPEQCAVEDELDFSQVTRLVTSEQGEESPDSSPEEQRSVIEIPTAVM
ETVPSCESKSKIPVRTAAATSQSLQQSENESLSPDDFLDSLQCEGKDDQAKPKSKIPVKT
AFQKAEPQHSYADTSVHKPESPKVLDVTSAVPVKPDSRSKSESDASSPVDPKTKRSIKAR
SYAEAEAEARERESEMKFELDSDEATTARSKVFSSRLPVKSRSATGSRGAFSPTKESKDH
FFDLYKNSIEFFEEISDEASKLVERLTQSEREQELVSDDESSSALEVSVIENVPSSDTQQ
SVPEDIFDIRPIWDESVETQIERIPDENVHDRTEDQQDDQERTEERLAHIADHLGFSWTE
LARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLTQCLTKINRMDIV
HLMETSGIDPMQGHGTRTYADTEQSLALDHSEGFSALQEEVYSSRHKQEQQRLSKDGEPT
EHPPLVSEEDVSVSYSPFQDSTPRSEAEVSMAELLRQAHKEQVEAEFSGKPQDVPGKPSA
SQQEYFVTTPGTEQSVGAGKAASGKSAHSSRAKGEAQTAHPQPPSPVQRGDSPIIQEPED
PQLHQESLSPRRSSLVIVESTEEQMEKSGRGFEEESLEKADSMPEMLPETVTEEQYTDEH
GHTVVKKVTRKIIRRYVAPDGMEKEEVLMQGTPQAPVTVEEGDGYSKVLKRVVLKSDSEH
SE
Download sequence
Identical sequences H0YUA6
ENSTGUP00000001874 ENSTGUP00000001874 59729.ENSTGUP00000001874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]