SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003717 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003717
Domain Number 1 Region: 135-267,330-396
Classification Level Classification E-value
Superfamily Hemopexin-like domain 5.15e-34
Family Hemopexin-like domain 0.0012
Further Details:      
 
Domain Number 2 Region: 43-85
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000127
Family Somatomedin B domain 0.001
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000955
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003717   Gene: ENSTGUG00000003607   Transcript: ENSTGUT00000003757
Sequence length 396
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:2201409:2217092:-1 gene:ENSTGUG00000003607 transcript:ENSTGUT00000003757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVSSCTGRCGAGYSREHDCQCDFNCHHYMECCPDFRKVCTVAASCAGRCFEAFERGRECD
CDADCERYGKCCPDYAEHCKEEQTKQNRTKITKPNFTNKLANFSSMNTIWKHTGRYPGSH
HQDVNSEVKVNDEKDLCSGKPADGMVALPNGTLAVFRGHYYWLLNGRTPPTTNPRRITDG
WGIPSPIDSVFSRCNCDGKIFFIKGPLYWRFTNGVMDNGYPKPLATGFAGLNGRIVATLP
VARYNNRPESVYFIKRDGNMQQYVYRQEPAKKCQRRARVTIRYPAFVPRVVIRRRFQRAV
QMPTVIRTVRINSHPSGFLLLAGVLRKEIQMTTYWRGLPKVVHSTLSVPNQNKPDGYDYY
AFSYNRYYSLDIGKRIARPVTALTGKTVSKDWYNCP
Download sequence
Identical sequences H0YZI3
ENSTGUP00000003717 59729.ENSTGUP00000003717 ENSTGUP00000003717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]