SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004872 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004872
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-30
Family PDZ domain 0.015
Further Details:      
 
Domain Number 2 Region: 9-63
Classification Level Classification E-value
Superfamily L27 domain 4.71e-26
Family L27 domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004872   Gene: ENSTGUG00000004736   Transcript: ENSTGUT00000004921
Sequence length 197
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:1272714:1283032:-1 gene:ENSTGUG00000004736 transcript:ENSTGUT00000004921 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYET
VDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYIS
RIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEE
MESRFEKMRSAKRRQQN
Download sequence
Identical sequences A0A1V4JP78 A0A218UH32 G1NJI3 H0Z2T0 Q5F425
ENSMGAP00000013502 ENSGALP00000039371 ENSTGUP00000004872 59729.ENSTGUP00000004872 9031.ENSGALP00000039371 ENSTGUP00000004872 ENSMGAP00000013502 NP_001026238.1.86415 XP_002194172.1.42559 XP_003206139.1.16129 XP_005492378.1.73095 XP_005530339.1.90289 XP_008503005.1.100939 XP_009095287.1.15306 XP_009554058.1.62272 XP_010562024.1.12557 XP_011573872.1.59079 XP_014745310.1.99236 XP_014809270.1.91963 XP_015281173.1.55130 XP_017682509.1.3805 XP_021256868.1.32913 XP_021394724.1.53032 ENSGALP00000019849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]