SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000006750 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000006750
Domain Number 1 Region: 625-1049
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.8e-113
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000178
Further Details:      
 
Domain Number 2 Region: 23-289
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.49e-82
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000207
Further Details:      
 
Domain Number 3 Region: 290-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 1.05e-79
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000197
Further Details:      
 
Domain Number 4 Region: 1384-1554
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.83e-61
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000725
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000006750   Gene: ENSTGUG00000006544   Transcript: ENSTGUT00000006818
Sequence length 1856
Comment pep:known chromosome:taeGut3.2.4:8:13136835:13161050:1 gene:ENSTGUG00000006544 transcript:ENSTGUT00000006818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGIILALVLTLVGSQKFDIDPGFSSRKSYLYSYEGWVLNGLQEKNLAKAGVRLSCKLEI
SGLPENIYLLKIRSPQLEEYNGIWPRDPFTRSSKITQMVSSCLTRPFKFEYSSGRVGNIY
GPENCPDTCINIVRGILNMIQITIKKSQNVYELQEAGIGGVCHTRYVIQEDKKNSRVSVT
KTVDQTNCQEKVVKSLGMAYIYPCPADVMKERIIKGTAAFSYKLKQSDSGTLITEVVSQQ
VYQISPFSEPTGVAVTEAKQQLTLLEVKSEWGSSPDISMQSYSGLRYQFPAVLPQMSVQL
IKTKNPEQRVIETLQHIVLNNQQDFHDDLPYRFLELVQLCRAASADTLESIWKQCSDKPR
YRRWLLSAVSATGTTEALKFIKSRIRSDDLSYLQALLSVPFALHLTKADEHTVSIAADLV
TSSRIQKNPMLQQLASLGYSSVVNRYCSQTSVCPKEVLQPIHDLADEAISRGREDKMKLA
LKCIGNMGEPASIKRILKFLPIFSSSASDIPIHIQIDAIMALRKIAWKDCKTVQGYLIQI
LADESLSPEVRMMACAVLFETRPALPLITTIANVAMKESNLQVASFVYSHMKALSKSRLP
YTYNISSACNIALKLLAPRLDRLSYRYSKVIRIGGYFDNYKVGAAGDILVMNSPGTMFPS
AIISKLMAYSAGSVADVVEAGVRVEGLTDVIMKRNIPFAEYSTYKKIKEIGKALLGWKEL
PTETPLISAYFKLFGQELAYININKEVLQQAVKAVLEPADRSAALKRLAGQLRSGGMAHW
TQPLWLGEMRYIVPTCTGLPLEYSSYSTALARAAASVDGKITPPLTGDFRPSQLLESTLQ
IRSDIKPSLYIQKFATMGVNTEYFQQAVEIQGKVLARLPMKFDAKIDMKLKNIKIETNPC
REETEIVVGRHKAFAVSRNLGELGVEKRTAILPGDASSNIVEEPFKPSDRASSEDFTKQE
ADSTSRKQAYNSQEDLHRVMERKTHKRDICIKLQHLGCQLCFSRRSRDASFLKNTYLHRL
IGEHEAKIVLIPVETDADFDKIQLEIQAGSRAASKIINEVNAESEEEGESSLYGDMKAKL
KKILGIENVFKIANKTRHQKKQPSKKENTVLTELGADPDTKHPSSSSSASSAVSSSSSSA
VSPRRKEAGDEDENNQEEQVKNKDASSKSSSSSGRSNKSSKSSSNSSDRSSKSSSSGRSS
KSSSSSDRSSKSSSSSSRSSKSSSSSSSSSDRSSKSSSSRSSKSSSSSSSSSSSSSGRSS
SSSSGRSSKSSSSSSDRSSSSSSRSSSSGRSSSSSSRSSSSGRSSKSSSGSSSKSSSGSS
SKSSSSSSSSTHEIYQYRFKSAHRQELPKRKLPDDQISSSQSSVRSSHASSRASWPKFLG
DVKTPVLAAFLHGIRDDKKIGGLQLVVYADTDSIRPRMQVFVSNLTDSSKWKLCADASVL
NDHKATAYLKWGRNCQDYKVSSELVTGQFADHPAVQVKLEWPKVPSSVRSVAEWFYKFVP
GAAFMLGFSEKTDKNPSRQARVIVALTSPRTCDVVIKLPDVTLYEKAMRLPLSLPVGPRM
PASELQPPIWNVFAEAPSAVLENLKAQCSVSYNKITTFNEVQFNYTMPENCYHILAQDCS
SDLKFLVMMKNAEEAVNLKAINIKLGNHEVDMRPANGRVKLLVDGAESPTNVSLTSAGAS
LWIHSENQGLVLRAPAYGIDKLYFDGYTCRIQVALWMAGKMCGLCGKYDAECKQEYRMPN
GYVAKDAVSFGHSWILEERPCRGACKLRHSLVKLERTVQLAGVESRCYSTEPVLRCTKGC
SPTKTAPVTVGFHCLPADSATGLTDKQMKFDQKSEDMQDTVDAHIACSCEDENCST
Download sequence
Identical sequences H0Z847
59729.ENSTGUP00000006750 ENSTGUP00000006750 ENSTGUP00000006750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]