SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010277 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010277
Domain Number 1 Region: 568-823
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-55
Family YWTD domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 267-497
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-50
Family YWTD domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 2-216
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-49
Family YWTD domain 0.00000436
Further Details:      
 
Domain Number 4 Region: 870-1129
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-39
Family YWTD domain 0.0000588
Further Details:      
 
Domain Number 5 Region: 1260-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000288
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 1222-1258
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1181-1221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 8 Region: 826-871
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000355
Family EGF-type module 0.039
Further Details:      
 
Domain Number 9 Region: 524-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000441
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 221-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000167
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1138-1191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000105
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010277   Gene: ENSTGUG00000009934   Transcript: ENSTGUT00000010386
Sequence length 1540
Comment pep:known_by_projection chromosome:taeGut3.2.4:5:16463108:16560271:1 gene:ENSTGUG00000009934 transcript:ENSTGUT00000010386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FWTDVSEEAIKQTYINQTGNVVQNVIISGLVSPDGLACDWIGKKLYWTDSETNRIEVANL
NGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSMRKIIVDSDIYWP
NGLTIDLDEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQT
RSIHACNKRTGEKRREILSALYSPMDIQVLSPDRQPYFHTPCEENNGGCSHLCLLSPRDP
FYSCACPTGVQLEDDGRTCKAGAEEVLLLARRTDLRRISLDTPDFTDIILQIDNIRHAIA
IDYDPVEGYIYWTDDDVRAIRRAYLDGTGAQTLVTTEINHPDGIAVDWVARNLYWTDTGT
DRIEVTRLNGTSRKILIAENLDEPRAIVLNPVMGYMYWTDWGESPKIECAYLDGSERRVL
VNTSLGWPNGLALDLEKNKLYWGDAKTDKIEVINVDGTMRKTLLEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKIKASRDIIIDQLPDLMGLKATSVTKAFGTNSCAENNGGCSHLCF
FTPQEARCACPIGLELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEA
SALDFDVSDNRIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADT
GTNRIEVARLDGQYRQVLVWKDLDNPRSLALDPTKGYMYWTEWGGKPRIVRAYMDGTNSI
TLVDKVGRANDLTIDYVDQRLYWTDLDTSMIESSNMLGQEREIIADDLPHPFGLTQYSDY
IYWTDWNLHSIERADKTSGKNRTLIQGHLDFVMDILVFHSSRQDGLNDCVQNNGHCGHLC
LAIPNGFRCGCAAHYTLDPNSRNCSSPASFLLFSQKSAISRMIPDDQQSPDIILPMHGLR
NVKAIDYDPLDKLIYWVDGRQNIIKRAKDDGTQPFTVMSTPNQSQNPEKQPHDLSIDIYS
HTLYWTCEATNSVNVHRLNGESIGMVLRGDHDRPRAIVVNAERGYMYFTNMQERAPKIER
AALDGTEREVLFTTGLIRPVALVVDNKLGKLFWVDADLKRIESCDLSGANRVTLEDSNIL
QPMGLTVLGNHLYWIDRQQQMIERVEKVNGYKRTRIQGRIAHLTGIHAVEELDMEEFSVH
PCSRDNGGCSHICIAKGDGTPRCSCPEHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIP
MAWRCDGFPECDDQSDEDSCPICSASQFQCEKGQCIDAHLRCNGEIDCQDKSDEADCDTI
CLPNQFRCASGQCILLKQQCDSFPDCMDGSDELMCEKSKPASDESQPHSSAIGPVIGIIL
SLFVMGGMYFVCQRVVCQRYAGPNSPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGK
SMISSMSLMGGSSGAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNAEM
FYSSNIPSNTRSYRPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPP
PPTPRSQYMSAEESCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences H0ZI60
ENSTGUP00000010277 ENSTGUP00000010277 59729.ENSTGUP00000010277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]