SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000010812 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000010812
Domain Number 1 Region: 215-356
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-42
Family Third domain of FERM 0.000000478
Further Details:      
 
Domain Number 2 Region: 107-214
Classification Level Classification E-value
Superfamily Second domain of FERM 2.09e-37
Family Second domain of FERM 0.000000745
Further Details:      
 
Domain Number 3 Region: 19-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-24
Family First domain of FERM 0.00000852
Further Details:      
 
Domain Number 4 Region: 505-580
Classification Level Classification E-value
Superfamily Moesin tail domain 4.45e-21
Family Moesin tail domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000010812   Gene: ENSTGUG00000010467   Transcript: ENSTGUT00000010925
Sequence length 581
Comment pep:known_by_projection chromosome:taeGut3.2.4:15:12774728:12814976:1 gene:ENSTGUG00000010467 transcript:ENSTGUT00000010925 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAIASRMSFSSLKRKQPKTFTVRIATMDAEMEFSCEVKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVPTEEPKTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIFCPPEASVLLASYAVQAKYGDYDPNVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPDNRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQCLAREKQMREEAERTRDELERRL
MQLKEEATMANEALLLLALSTAESFLEALYACPKTAPKLLLVASEQQAGWSYFILQGCLG
GAQRGQLCFWVLSAAVLCIPQILLSSHEAKEADQLKQDLQEARESERRAKQKLLEITSKS
SYTSMNSSTTALPTDLPSYNLISESLSFDFKDTDMKRLSMEIEKEKVEYMERSKHLQEQL
NELKTEIEALKLKERETALDILHNENSSRGNSKHNTIKKVS
Download sequence
Identical sequences H0ZJP3
ENSTGUP00000010812 59729.ENSTGUP00000010812 ENSTGUP00000010812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]