SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011392 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011392
Domain Number 1 Region: 195-338
Classification Level Classification E-value
Superfamily PH domain-like 3.44e-44
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 85-194
Classification Level Classification E-value
Superfamily Second domain of FERM 1.06e-38
Family Second domain of FERM 0.000000937
Further Details:      
 
Domain Number 3 Region: 495-582
Classification Level Classification E-value
Superfamily Moesin tail domain 6.54e-31
Family Moesin tail domain 0.0000267
Further Details:      
 
Domain Number 4 Region: 2-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.94e-25
Family First domain of FERM 0.0000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011392   Gene: ENSTGUG00000011044   Transcript: ENSTGUT00000011516
Sequence length 582
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:53202007:53220056:1 gene:ENSTGUG00000011044 transcript:ENSTGUT00000011516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INVRVVTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFQTWLKLDKK
VSAQEIRKENPLQFRFRAKFFPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPETAVL
LGSYAVQAKFGDYNKEVHKPGYLNSERLIPQRVMDQHKLSREQWEERIQVWHAEHSGMLK
ENAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSE
IRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTIEVQQ
MKAQAREEKHQKQLERKQLEDEKKRRETIEREKEQMLREKEELLVRLQEYEVKTQKAEKE
LSDQIQRAIQLEEERKRAQEEAERLEADRLAALQAKEELERQTLDQIKSQEQLATELAEY
TAKIALLEEARKRKESEVEEWQIRAREAQEDLVKTKEELHLVMTAPPPPPPPVYEPVNYH
VHDNLQDEGSEYSAYSAEFSSEGIRNDRNEEKRITEAEKNARVQSQLRALTDELAQARHE
DKRTQNDIIHSENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences H0ZLB9
ENSTGUP00000011392 59729.ENSTGUP00000011392 ENSTGUP00000011392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]