SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000011605 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000011605
Domain Number 1 Region: 203-343
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-44
Family Third domain of FERM 0.000000176
Further Details:      
 
Domain Number 2 Region: 93-202
Classification Level Classification E-value
Superfamily Second domain of FERM 9.55e-39
Family Second domain of FERM 0.000000765
Further Details:      
 
Domain Number 3 Region: 500-587
Classification Level Classification E-value
Superfamily Moesin tail domain 3.01e-33
Family Moesin tail domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 6-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.65e-26
Family First domain of FERM 0.00000714
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000011605
Domain Number - Region: 438-481
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.0235
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000011605   Gene: ENSTGUG00000011248   Transcript: ENSTGUT00000011731
Sequence length 587
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:45511374:45538619:-1 gene:ENSTGUG00000011248 transcript:ENSTGUT00000011731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTRKMPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYS
TWLKLNKKVTQQDVRKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKESILNDEIY
CPPETAVLLASYAVQSKYGDYSKEIHKLGYLANDRLLPQRVLEQHKLTKEQWEERIQNWH
EEHRGMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTP
KIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
PDTIEVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLRQIEE
QTMKAQKELEEQTRRALELDQERKRAKEEAERLEKERRAAEVAKAALAKQAADQMKNQEQ
LAAEIAEFTAKIALLEEAKKKKEEEASEWQHKAFAAQEDLEKTKEELKSVMSAPPPPPPP
PVIPPTENEHDEHDENNAEASAELSSDGVMNHRSEEERVTETQKNERVKKQLQALSSELA
QARDETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences H0ZLY2
ENSTGUP00000011605 59729.ENSTGUP00000011605 ENSTGUP00000011605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]