SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000017361 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000017361
Domain Number - Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000238
Family Laminin-type module 0.04
Further Details:      
 
Domain Number - Region: 36-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0209
Family Laminin-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000017361   Gene: ENSTGUG00000017082   Transcript: ENSTGUT00000017750
Sequence length 64
Comment pep:novel chromosome:taeGut3.2.4:Un:55459233:55461256:1 gene:ENSTGUG00000017082 transcript:ENSTGUT00000017750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHHVTGECSCPPGWTGHDCKHPCSSGRWGRGCANSCACQGGDGGCDPATGTCSCQPGFTG
QHCQ
Download sequence
Identical sequences H1A399
ENSTGUP00000017361 ENSTGUP00000017361 59729.ENSTGUP00000017361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]