SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|389850314|ref|YP_006352549.1| from Corynebacterium pseudotuberculosis 258

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|389850314|ref|YP_006352549.1|
Domain Number 1 Region: 209-390
Classification Level Classification E-value
Superfamily TPR-like 0.0000108
Family Tetratricopeptide repeat (TPR) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|389850314|ref|YP_006352549.1|
Sequence length 405
Comment hypothetical protein Cp258_0976 [Corynebacterium pseudotuberculosis 258]
Sequence
MADSHSREGRSQRGFKSRDGRRQGGERERRGESSWGRNDRHEGSNRRPGSQSDGRRESYG
RRRDENDRKSGRPYDRDRKERFGDRGKRSEERRDDRRQRPKWDDDRRVPRQEDRRKDWKT
GERRSGEPKRGGRSEYRRGDGDRSSRPYSERNGERRHSQRGGVDRNKQQRGPIRPGYREE
RINNRVNEPDLPDDIDVRDLDPMVLQDLKVLAKDNANAVAKHMIMAATWMADDPQLALNH
ARAAKDRAGRIAVVRETCGIAAYHAGEWKEALAELRAARRMSGGPGLIAVMADCERGLGR
PEKAIELARDEDPASLDVETRIELAIVVAGARLDLDQPDAAVVILQRENPDASGTGLGAV
RLSYAYANALLAAGRESDAKEWFAIAEKQDVDGYTDASERLQELA
Download sequence
Identical sequences A0A1L6D029
gi|387138562|ref|YP_005694541.1| WP_014523271.1.10260 WP_014523271.1.16076 WP_014523271.1.23262 WP_014523271.1.27807 WP_014523271.1.38385 WP_014523271.1.38411 WP_014523271.1.40681 WP_014523271.1.43256 WP_014523271.1.56904 WP_014523271.1.6216 WP_014523271.1.6597 WP_014523271.1.73584 WP_014523271.1.75733 WP_014523271.1.81226 gi|389850314|ref|YP_006352549.1| gi|387140560|ref|YP_005696538.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]