SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_01993--XP_001602018.1_NASVI from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_01993--XP_001602018.1_NASVI
Domain Number 1 Region: 14-74
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.000000662
Family Insect phospholipase A2 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_01993--XP_001602018.1_NASVI
Sequence length 77
Comment [mRNA] [translate_table: standard]
Sequence
MRVRGQVVEQRRHRFRTCLKMAGTASADFIGKIFFDVLQTKCFVLKTQKICLKRNWWGEC
ARHEYRKQAYIRDNVPY
Download sequence
Identical sequences E2BPE9
Hsal_01993--XP_001602018.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]