SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_03241--XP_395730.2_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_03241--XP_395730.2_APIME
Domain Number 1 Region: 310-367
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.42e-23
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00012
Further Details:      
 
Domain Number 2 Region: 5-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.00000000000000523
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_03241--XP_395730.2_APIME
Sequence length 367
Comment [mRNA] [translate_table: standard]
Sequence
MSLSHSTVLKLYNTVIEDVISGVRESFIDEGVDEQVLQELKQIWETKLLSCKAVEMNPDP
PESQVPQLNPLKAISINKASIGNHYIQTGNTVPTQQQPQPKPQQPQQQQPQQQQTQQQPP
QQPQQQQAQQQRPTPQQHTLPTAGTTTLQQHSSAPVQQVVTAPAAVLDRQVPIQITLPPQ
TGVPDAPQRILTIQVPASAIQENQLHTILTGPVISAAMGLPANLASTLLQQHVNATLQGQ
ATLTPLQVNQPIQQNNIAQLDGAAGDSSDDDDEEEEEDNDDDDEDLDDKEEEENDEAAAR
EEEPLNSEDDVTDDDPADLFDTDNVVVCQYDKITRSRNKWKFYLKDGIMNLSGKDYVFQK
ANGDAEW
Download sequence
Identical sequences E2B5F4
Hsal_03241--XP_395730.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]