SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_03385--XP_392825.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_03385--XP_392825.3_APIME
Domain Number 1 Region: 147-241
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.97e-29
Family Insect phospholipase A2 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_03385--XP_392825.3_APIME
Sequence length 264
Comment [mRNA] [translate_table: standard]
Sequence
MYSINIRTCLLVVSACGLTAQQPTFFKSTFKGLNGLTSGISVLADNEIRAVYYYEQTVAV
VDLGPRNVLHDCNIIEVYEPSEAAEVIRNLSVTLHPQVVSFQEITRLMQQCELLDSIRVE
TTSTSPTNVLSRGTRIAASSITLLSGILPGTKWCGTGDIAESYHDLGDVPYVDRCCRTHD
LCPVKIRAQQTRYNLTNYSLYTKSHCTCDKGLYRCLKAANHPTANLLGQIYFNIIKVECI
EDMQTNQHIPSEPLKKFVPVKREY
Download sequence
Identical sequences E2BY60
Hsal_03385--XP_392825.3_APIME XP_011147265.1.56509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]