SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_06297--XP_001120794.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_06297--XP_001120794.1_APIME
Domain Number 1 Region: 3846-4213
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.28e-125
Family Hect, E3 ligase catalytic domain 0.0000000691
Further Details:      
 
Domain Number 2 Region: 1692-1759
Classification Level Classification E-value
Superfamily WWE domain 0.00000000000000824
Family WWE domain 0.0041
Further Details:      
 
Domain Number 3 Region: 1399-1450
Classification Level Classification E-value
Superfamily UBA-like 0.000000000102
Family UBA domain 0.0099
Further Details:      
 
Domain Number 4 Region: 288-442,572-754
Classification Level Classification E-value
Superfamily ARM repeat 0.000000221
Family PBS lyase HEAT-like repeat 0.07
Further Details:      
 
Domain Number 5 Region: 103-147,309-392,857-921,1512-1557,1788-1977,2102-2182
Classification Level Classification E-value
Superfamily ARM repeat 0.00000779
Family Armadillo repeat 0.054
Further Details:      
 
Domain Number 6 Region: 2962-3072
Classification Level Classification E-value
Superfamily MgtE N-terminal domain-like 0.0000432
Family MgtE N-terminal domain-like 0.019
Further Details:      
 
Weak hits

Sequence:  Hsal_06297--XP_001120794.1_APIME
Domain Number - Region: 2906-2967
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000225
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_06297--XP_001120794.1_APIME
Sequence length 4220
Comment [mRNA] [translate_table: standard]
Sequence
MKIDRSRLKKCTSEVPTECQTLINKLRSCSHAELLEELKQIDAWTFGKCELFHWIDVLDL
SDSILEEAAARSPDNPWELACDLPQNREAKELLLWVLHFTTLLIEHSFSRHLYNSMEHLV
TLLSSCDMHVVLGVLNLLYMFSKRSNFITRLNSDKRQALLSRLNHLAESWGGKENGFGLA
ECCKEYPEKPFPTSATTLHFEFYAENPTVSEPSTTGTSLPSTKKVGQANLVTYIHIEAVD
KLGKTPAQIMNDLLKVYNVPQERQMALLTHIRLAHSFSDYRRRLQCVQARLQALSVLVYS
NALQENAHSLLHAGLLEELVELLELPHTHLVEIRAAALRTLTSIIHLDRNPHFPKKPGSR
LNMIIDVTGASSYHGFLPVLVRTCITTLTSPQSDGQPFPLPLATALFSFLYHLASYEAGG
EALVSCGMMESLLKVINWPGSELEHITFVTRAVRVIDLITNIDMQGFQTHGGLASFINRL
DMEVNVCRKEQPFEIEPLLYQDTPQTSRERSVDREEESSTSRRVHETFDEREESSNPMEF
SEDENMSSKTDEKSEQQPDYSAAKTGKTCLPQRAALLKSMLNFLKKAIQDPAFSDSIRHV
MEGTLPSSLKHIISNSEYYGPSLFLLATDVVTVYVFQEPSLLSSLQDNGLTDVVLHALLI
KEVPATREVLGSLPNVFSALCLNQRGLESFVKRRPFERLFKVLLSPVYLSAMRRRRSADP
LGDTASNLGNAMDELMRHQPSLKVDAIQAIIKLLEELCVLGCDPRYICWRAASKSDNSPS
NITTGNRQSSGQSVGVGVGDSGGAGGGGGGSSSDEEEEDEEEASTSSHPQREEQPSPSPA
QPGPPPQPREKTPIALVEYIHNVMKFVDAILSNNSTDDHCREFVGQKGLVPLLSILGLPN
LPVDYPVAQAAQSVASVCKSILNLAHEPAVLKTGLSQLNEVLTLLKPLHSHMESPGGSVL
LHELASAPNLETAFTSDTATPLLHAMNAAHGYVVMFVHVCRTSQSEIRNLSMNHWGSDVG
LAVLDGLSDLYMSLVWESTLLLALCSEDIIPAGCEFGKEDMDKLMPPELKTEGESSTWSG
TASADMGSNGMTTAMEALSTDPPPVPMEVDDKPNVSTGRASPNNYQLKYIKPLLGASSRL
GRALAELFGLLVKLCMGSPVRQRRGQQMPLTPALPSQAARNVASSLNGLLTRGLSWDKLP
PSPIPKFKLTFLICSVGFTSPMLFDEKRHPYHLMLHKFVLSDGQSSFFATFHWALSGGGQ
FALTEGLEHPNLPDGTGEFLDAWLMLLEKMVNPKAILDSPHVVSAKCSGMFKEPPFEPIK
YLTEIHKKAFEAVMLMWGKKPLKNYGARMTESILSILRHILRGEKIIKERTEKKEENVEG
AVASGSGGTSGIARSGTSDRRDEPEADVNPEYLRQLMDMGFSRAHCIEALMHTLTVEQAT
DYLLTNPATLRRPDAALNDVGGQVMDVETDDDLMHAIAVSLDSPDAHKIGVGIEEFGRET
TITENIDEFTHSALEQCLHLLDLMPDTVYRICDLLVTITKRNGDEWRDSMLRQLIREIGI
LVDHLIQIAEGQDENAGTRLVECEEANKVAGRIYLYTLFFEGTFQEMRVPCAQIVEECAI
LDKLVRLLVVSEGPLTATKNRLAKDNKDSGATTSGVKTPKWLAPLLLLIDRLEKVAILTK
RKQLMHKVTTRAWKWFDLSTGKWTLYSPMNNRIINDAYWAGESSVRISCSRRRYLITFSC
MTQVNEDTDNRRPITMCFKLNTGNNEDGGSGSDSNMDTDESPIEEKRNTVVQGLDPSIAP
SIVRACVKLLAIPVDRDALHALMKVCLRLTRDYKNAEVFAREGGVKLLLEMTHMSSFTGC
INLSTLLIRHTLEEPRTLRLAMEKVIRTRTQINIPPAYKEILFMTRQISSAVCRNPEVYK
EVCENILRVDISVLKKDDVDNRLVVKALPPSHSPALPMVEEVSVGVIRDLLNALIKPMPI
SSDDGTITPTSPEKKSSHSTSSSAIGNATSSTSSRRDVLRNNTTTTNDPLDDDDQVSQII
PLKIYTDIGSSSKVEPEEAKKPVLTKSAILKILAEAVRSYGAVASLITEHTYRAGQSEMV
AEDTTALAFLLDKLLPMLPENSSDRTCSGMARMLIAAIASCNHSPDVQTTLVTEVKAALT
RTLALPESSEKHAQLQLLIGLISTMIDSCPPTSHTQLRASLKAHQYNNVNYIVRIMLRKG
IITDLAKIPHSLDLSSPNMAATINAALKPLETLSRIINQPMPGAVNNKFTKPKNRTVQEE
PIGEQTGTTTSEATHAVGEEANEDAENTEHDISVTAESLEPASEGQVHEEGDEAALEDIM
DQLLERDGSAVAEEPSSRPHRPMDIDDESLAMRDAEGDFDPTRDTTEDLMSSDSDSDSNP
SDDNEDEVQDDEDEEEEEEDDGEENEEEEEEEEEGSSNYEEDGIEFYEDAGEGGVFRMFP
SNERDGGNVVMIQHNIENQDIANTSTPVTTRPSLPTWNTTFPLPLGLFEEPPTVSENNGI
STHPLLISQGSLDTASNRSQRALRQRRYQYLQLSNPRSPNPPVILQRLLGPAAQTLPLSA
SQVLASSFRDTRVVVMDNGLGIFTNQEEEQIDYVDQSGYLFGPSLAATLNNIPTALHWWI
EESKQLDGDSQPDCCVGVVHKLIPGLEKYRNAELAERKEKRKKQHGSEKDNEKDSKDEKE
RLNTTESGSSSLIQMDEQRSSASTSQRTDATPLVAGEETTVETTRQERTPEEDIIDVTGE
MEVTVQEDEERPPPPPPPEDQSSSSESRDPRTANRNPTLELAESIVDSVLGPWQPVRSAE
STNTTESSNRAAAPIVVDFGQETSEDLSRESSDSADWIRRLLTDDNQSSVERNANVVSQD
PTCSTSETTTTTTTTSNTETSEQSQQSSQQQQQQQQQSQLQQQPSQPQQQQQQQQSQQQQ
QQQQQQQQQQPPPPNWQPQEQQLPDGVDPSFLAALPEDMRDEVIAEQLRLQRIRQRAAVV
EELTGPVEVNPEFLAALPPAIQEEVLAQQRMEQQRHAAASANPEDPVDAAAFFQNLQPSL
RQAILTDMEESQISVLPPELAQEAQNLRREWEARNRHMMQERFLNHVSQGNTALSSILRN
SGRARGGGTRYAIHAVPQRSQWSAWNTRGDANIAHQGAGLRLRGRQLLDHESMACLLVLL
FVDEPKINTLRLHRVIRNLCYHGSTREWVVKALLNIMERSNDENKDIIADLSGKFKRKGL
LPSMDLCSPKIFDQRNNTQSWLNISIDAALGCRANVFHIIRHAGKKSERQGNIIAIHPQA
APTVCRHTLELLISLAKSFPGYFVPIKSKESDDKDSNKEKDVNASKEEGGAKGKSTSKIG
RSDLPDFWDMLLKLDSCASKKGKSVARTHSNTNLGNEPEHGITTFEASAFGQLISMLNWS
VIKRSSQLTDKLLRLLSLISIGLTEVNPYRRQEGTKNKKTEVNKEHSVAAPEGHLKLAVQ
VLTSKSCSEEGLEDATALLLNLSHCPDPTRQLILKLLLEGAMELANMVCEHINDLMMELK
VLNRELSRRNSLEDQPSTSTGGNGGRGILLDRFTNENVVVTAPSKVKAGSDLQLPSMAAL
VSKTSSQAFFLRILKVIVQIREAVRLANTKKTANQASETAMDTGTTSNAPETAAENVADV
DIPMDTTQANSSNLDNSKTSSRNDEEKAALPLLSESLVLDNLWETLSACLLELEYTPDHH
AVLVLQPAVEAFFLVHSSSSTSRDRHLNTNSETREVVPELAPVSPIYSDNEGTSQTEATN
STSWDITPAPQKTLPPDQLKFLKFAETHRTVLNQILRQTTTHLADGPFSVLVDHTRVLDF
DVKRRYFRTELERMDEGIRREELAVHVRRSHVFEDSFRELHRRNADEWKNRFYIVFEGEE
GQDAGGLLREWYVIISREIFNPMYALFTVSPGDRVTYMINSSSHCNPNHLCYYKFVGRVI
AKAIYDNKLLECYFTRSFYKHILGILVKHTDMESEDYSFYKGLVYLTEHNISDLGYELTF
STEVNEFGVNDVRDLIPNGHNIVVTEETKLEYIRLVCQMKMTGAIRKQLNAFLEGFYDII
PKRLISIFNEQELELLISGLPNVDIEDLKANTEYHKYSATSLQIQWFWRALRGFDQADRA
KFLQFVTGTSKVPLQGFAALEGMNGVQKFQIHREDRSTDRLPSAHTCFNQLDLPVYETYD
KLRTNLLKAIHECSEGFGFA
Download sequence
Identical sequences E2BHC6
Hsal_06297--XP_001120794.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]