SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_08480--XP_623063.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08480--XP_623063.1_APIME
Domain Number 1 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 7.06e-18
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00017
Further Details:      
 
Domain Number 2 Region: 52-102
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.07e-17
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_08480--XP_623063.1_APIME
Sequence length 170
Comment [mRNA] [translate_table: standard]
Sequence
MSYQLYRNTTLGNTLQESLDELIQYGQITPQLAIKVLLQFDKVINQALATRVKSRLTFKA
GKLNTYRFCDNVWTFMLNDVEFREVQEVAMVDKVKIVACDGKSKYIYKCGLCNILNIFKF
ILYTYIYSNMFNLNNLHKNNKFSFSVCFSSLIIYLYNLLYSFIFLNMNSE
Download sequence
Identical sequences E2BFC2
Hsal_08480--XP_623063.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]