SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_09131--XP_392825.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_09131--XP_392825.3_APIME
Domain Number 1 Region: 51-155
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.21e-22
Family Insect phospholipase A2 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_09131--XP_392825.3_APIME
Sequence length 243
Comment [mRNA] [translate_table: standard]
Sequence
MRRSDAIGLFALCVLVLLAGDSSAISHFLRKYLPTLLRSPWKELSTLRHGIVPGTLWCGP
GHIANNYSELGSNWQLDECCRAHDFCTDYIRPQQSKYGLYNSAKLCRSSLCDCDLQFYNC
VKKAPGFIAFSVGKIYFKNCKFCFRRFDDADTCMEKGLTVSEGTSRDGHRAFCAQFDRNP
KWGHRRHLESSESIPAATLPTWIDSEPVQTIPESYPVDDNQSAEEDEDDETSQDIDLSML
NVS
Download sequence
Identical sequences XP_011137692.1.56509 XP_011137693.1.56509 XP_011137695.1.56509 XP_011137697.1.56509 Hsal_09131--XP_392825.3_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]