SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_12191--XP_001121504.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_12191--XP_001121504.1_APIME
Domain Number 1 Region: 665-845
Classification Level Classification E-value
Superfamily BRCA2 helical domain 5.36e-39
Family BRCA2 helical domain 0.0000334
Further Details:      
 
Domain Number 2 Region: 846-974
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.94e-35
Family Single strand DNA-binding domain, SSB 0.0000763
Further Details:      
 
Domain Number 3 Region: 1186-1326
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-26
Family Single strand DNA-binding domain, SSB 0.0036
Further Details:      
 
Domain Number 4 Region: 980-1008,1114-1175
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-16
Family Single strand DNA-binding domain, SSB 0.01
Further Details:      
 
Weak hits

Sequence:  Hsal_12191--XP_001121504.1_APIME
Domain Number - Region: 1009-1060
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.000602
Family BRCA2 tower domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_12191--XP_001121504.1_APIME
Sequence length 1458
Comment [mRNA] [translate_table: standard]
Sequence
MKSNIGFQTARGTPINISKQALTRAKLMFATELDEPLEPNVAEQANICDREVKEKNARSP
SIGFQTARSAPINISKHALTRAKLLFAKELDEPLEANVVQEVNARDKEVKVQEVETPSVG
FQTARGAPINISKQALTRAKLLFAKESDEPSEANVVQEVNTRNKEVKVQEVEPPNVGFQT
ARGAPINISKQALTRAKLLFAKELDEPSEAIVVQEVNTRDKEVKLQEVEPPNVGFQTARG
APINISKRALTRAKLLFAKELDEALEANIVQEVNTRDKEVKVQEVELPNVGFQTARGASI
NTSKQALFKAKLLFARELDEPLEHDVAEKINISNREIEIQEAKTPGTDEFQTALGTSINI
SKQALSKAKLLFTKEFDGPSGFNLAERANINSELVKEQEVRVSSVGFRTARGASISISKQ
AFSKAQALFADQLDSPTESNLPEKRKLTSDDSTPLGRGFAWGLKKVRLSNEFGGRKLFPD
CSSADMDVNDTMKIQLDDDFRVASRMSTNDGRIETVPIAESPNEAAASRMEYPDERNQAD
PAMDVSVCSPQRDTSEFPESNTEGSPIIGRQPVSRKRWSLEYRRSKQSTSQLDDRTSPED
ANSMATSPHREKTNEEESQRVTQPERQKAESTSESTEYGDTQMMMDFIDESAQILQDRLA
AALEQENAITDKSRRRSRQSPGYLYRHKQINSGARVSLRDLADGAPPRPRTCQELIDQRI
PPNILAISSATAASYKFRCSDFYGNDVARSNVRGIELEDGARLVMDENGYVGVWEFLRAF
LASPGVEPSLVPARWIENHYRWIVWKLASLDRMKFGSAELPRALTPSHVMAQLKYRYDRE
IDRSQRPAIRRILEQDDVASKRMILCVSSIVESNAVANSTVEMGKSPRVGMSKWRIELTD
GWYNIPACIDLAMIKYVSTGKVREGTKLLVYGAELLNCNVACYPLEAPADVCLKLHTNST
RRARWDLKLGYAPRSGPISVRLRDVCPNGGLIGKMTIVVARVYPMLYHEKTVSGESVLRN
AKSEEKAQTEYEQRCRHKAEAFYDKAEKDFQEEDLSCETDLLAGKSRENSTQAFAGKKQQ
DDLLRELRMKKERYKQELQSKLRESLPAPRQVSPLLKVRVCDGSANAILSVWSPGEEVVD
ALKEGACVSLRNVIAAGKRGCELQLTARRCALFNPGTMPDASYPVRLCASFRQVGSPEFS
PPYGEFDTVGLVCAVGTAPYSMKDFEAVHLACPRIDSSGSLYLSILFWQGIASYGYAEVL
TVGSIVACNNLDWRRMTSWNVPVAYCTDRSTFTRNPRRNHLYESFESLCDSITNPIAYAE
GCTAELNVELQKKPATMRTPTRYASDKNIPIKIYNSVSGSDKRPVDHTPSPSLSTPRSTA
ANNSWNFSTNSPLIQKRLDKLQQYGEPPELSPIIMKSSKRVFLDYRSPVGVSDASSTTIT
SSTSKHGRSNPCLSPEKQ
Download sequence
Identical sequences E2BM50
Hsal_12191--XP_001121504.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]