SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_15068--XP_001122233.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_15068--XP_001122233.1_APIME
Domain Number 1 Region: 1-319
Classification Level Classification E-value
Superfamily UROD/MetE-like 4.45e-90
Family Uroporphyrinogen decarboxylase, UROD 0.000000832
Further Details:      
 
Domain Number 2 Region: 415-696
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.82e-70
Family RecA protein-like (ATPase-domain) 0.000000013
Further Details:      
 
Domain Number 3 Region: 373-450
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.48e-28
Family Cold shock DNA-binding domain-like 0.0000349
Further Details:      
 
Domain Number 4 Region: 326-368
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.000000000118
Family Rho termination factor, N-terminal domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_15068--XP_001122233.1_APIME
Sequence length 743
Comment [mRNA] [translate_table: standard]
Sequence
MRQAGRYLPEYRKIRQIAGSFLDLCYTPALAAEVTLQPIRRFGFDAAILFSDILVIPHAL
GRDLHFEEGRGPQLTPVTVHDISKLTDNGAVERLAPVYETISLVKQDIDEKTALIGFCGA
PWTVATYMIAGHGTSDQAPARLFGYENPQAMQDLLNCLADVSADHLIAQIEAGAEAVQIF
DSWAGVLDETSFEAFCVAPVRRMVERVRRRHADTPIIGFPRGAGVLYTDYAQKTGVTALG
LDWSVPLSFAQKLQETVPVQGNLDPVRLVAGGKALDEGVDMILQALGSKPFIFNLGHGIT
PQTPIAHVEQMVKRVRGQGFSSMQEMKLQELKSKTPVELLAFAEELEVENANAMRKQELM
FAILKKLALQEIEIIGEGVVEILQDGFGFLRSADANYLPGPDDIYLSPSQIRRFSLKTGD
TVEGPIRSPKEGERYFALLKVNTINFEDPDTIRHKIHFDNLTPLYPNERLRMEMDNPTGK
DMSQRVIDLVAPLGKGQRGLIVAPPRTGKTVLLQNIAHSITANHPECYLIVLLIDERPEE
VTDMQRSVKGEVVSSTFDEPASRHVQVAEMVIEKAKRLVEHGRDVVILLDSITRLGRAYN
TVVPSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALVDTGSRMDEVIFEEF
KGTGNSEIVLDRKIADKRIFPAMDILKSGTRKEDLLVARQDLQKIFVLRRILSPMGTTDA
IEFLIDKLKQTKTNSEFFDSMNT
Download sequence
Identical sequences E2B9L8
Hsal_15068--XP_001122233.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]