SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_17535--XP_001600107.1_NASVI from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Hsal_17535--XP_001600107.1_NASVI
Domain Number - Region: 5-47
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 0.00466
Family Insect phospholipase A2 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_17535--XP_001600107.1_NASVI
Sequence length 78
Comment [mRNA] [translate_table: standard]
Sequence
ELRIPGYQFCGPGTRLIKRFARGDQGINSLDAECREHDIAYSRSNNLADRHAADKILAAK
AWKRITSKDSTLGERAAA
Download sequence
Identical sequences E2BU69
Hsal_17535--XP_001600107.1_NASVI

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]