SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_00006--XP_392451.3_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_00006--XP_392451.3_APIME
Domain Number 1 Region: 490-586
Classification Level Classification E-value
Superfamily TAFH domain-like 1.57e-32
Family TAFH domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 812-861
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000272
Family TBP-associated factors, TAFs 0.0048
Further Details:      
 
Weak hits

Sequence:  Hsal_00006--XP_392451.3_APIME
Domain Number - Region: 113-193
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000126
Family beta-sandwich domain of Sec23/24 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_00006--XP_392451.3_APIME
Sequence length 1022
Comment [mRNA] [translate_table: standard]
Sequence
MASAKFLEEALSTDVDESAVNAIVGSLETQLVTSTPTVAGHQASSASVSQQNHQVNSAIS
NGGTITTVQSQKHGVSNGGGATTVNSLMTQEVAKSITTSTLLPVNVVTSNAVAPQVITTQ
QQQQQQQQQQQPQQQQQQQQQPQAQQTQQQQHTQASGISAYINQVTTNQVSSNQTTHIPS
LTKSHEPVKIIYPAVGQVIATTGVANANNKLTFPAQTVGQLANGTLGITSPAVLQTTSNA
VSTVGSVSQTGSQTVTGVNKPTGTTLVIKTSVAPAGMVSVPMTVPVSGNAVSTALQAKAG
VTSTIVPSNVQILNVNTMRPATPVAGQQANKQVTSRVVIGQPMVGTRSGPQGITFQALHG
LQPGTQGHLLLKTENGQFQLLRVGPAPPPGTPTGTAVTPNSIAGNAVVAAPSPGTTYRLA
SVPAVSRLNTQFTGPPLATLRKSVQTVAATITTSTTTPTTVTTAATTTTAQTVTPVQTVQ
TSASRPNPENTKEKCRKFLANLLELSSREPKAVERNVRTLIQELIDTKVEPEEFCDRLEK
LLNASPQPCLIGFLKKSLPLLRQSLVTKELVIEGIKPPPANVVFSIASTVPTITQQNQFR
PTVAVTTTVPITTTATATTQVRVMTPLPAAAVAVAAAAPTPAPAPTPVPAPAPAQVTVAA
VTAATVVTTTVPRPAQPVQQRLVRPVTTVVRSPTTAYTVKSTVAVTGIRPTAPVVQKPPI
MTTVVKTIATTTQGKTVNTTTTVNKAVVPSLVQKPAAKEKEKKSFSSAGYTADDDINDVA
AMGGVNLAEESQRILGSTEFVGTQIRSCKDEVFLHITPLQQRIKQITSNYGLEEPSQEVA
ALISHAAQERLKNLVEKLALIAEHRIDLIKVDPRYEVTQDVRAQLKFLEDLDRVERRRHE
EQERELLLRAAKSRAKTEDPEQAKLKAKAKEMQRAEMEELRQREANLTALQAIGPRKKPR
LDIAGTTNSSGSTTANASHSGPNRQISMRPRFKRVNIRDLMFLLEQEKETCRSTMLYKSY
LK
Download sequence
Identical sequences E2C106
Hsal_00006--XP_392451.3_APIME XP_011148720.1.56509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]