SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_01890--XP_001121740.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_01890--XP_001121740.1_APIME
Domain Number 1 Region: 1-232
Classification Level Classification E-value
Superfamily CutC-like 3.4e-67
Family CutC-like 0.00000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_01890--XP_001121740.1_APIME
Sequence length 235
Comment [mRNA] [translate_table: standard]
Sequence
MEICIDCLESARNAVAGGATRLEVCSALSEGGLTPSPGLVRQIKNFAKIPIRAMIRIRKG
NFVYSREEIDAMLHDLRILKDHQVDGFVFGALTLDGHVDLDVCCEIVSVARPLPVTFHRA
FDETVDPLKSMESIIDLGFDRILTSGQKDTALQGLSLLKRLVDKAADRIVIMPGAGIARD
NISQIKQCGAREFHASARKKVYVDPNGHRFAKDNFIDVTDRELVQTLVDIVHDVS
Download sequence
Identical sequences E2C1L5
XP_011148999.1.56509 Hsal_01890--XP_001121740.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]