SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_08614--XP_001122134.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08614--XP_001122134.1_APIME
Domain Number 1 Region: 457-542
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000628
Family Anti-sigma factor antagonist SpoIIaa 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Hsal_08614--XP_001122134.1_APIME
Sequence length 604
Comment [mRNA] [translate_table: standard]
Sequence
MGEVNFIKKTVRNRVPALKWLPRYKAEDALGDLVAGLTVGLTLIPQAIAYAGLAGLEPQY
GLYSSFAGSFVYIIFGTCREVNIGPTALISLLTWTYARGIPEYAALLCFLSGCVTILLGI
LRLGFLVEFVSIPVVSGFTSAASLIIACSQIKGLLGLSIHGESFVDIWHELANSITDTKI
PDLILSCCCIPILLLLKHLKDKKVSDIKLKRFLWTIGTARNALVVILCAVASYIFETRGG
APFVLTGHINAGLPSVEPPPFWRKVGNETESFIDMAKNLKTGILVVPLISIIGNVAIAKA
FSRGMPLDATQEMLTLGLCNVVGSFFHSMPVTGSFSRSAVNNASGVRTPFGGVYTGVLVV
LALSLLTPYFYYIPKATLSSVIISAVIFMVEVGMVVPLWKCNKRDLIPAFVTFLACLFAG
VELGIVIGVTIDLAILIYLNARPAIYIEYRNTAAASYVLVRPSAGLLFPAVDYLRTYLTE
VLSKKYQSSLKNPKILMNVVLDCEHIDKIDFTAAQGISTVVKDFDDKNRQLIMLRPNGDV
LKGVQSMLSKPILMAKNDVDLLTILNDLKTVERFSRDSKNFIEIDTSNCKIVSDGTNELI
TTKL
Download sequence
Identical sequences E2BSP6
XP_011144497.1.56509 XP_019698356.1.56509 XP_019698357.1.56509 XP_019698358.1.56509 XP_019698359.1.56509 XP_019698360.1.56509 Hsal_08614--XP_001122134.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]