SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_08868--XP_001122599.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_08868--XP_001122599.1_APIME
Domain Number 1 Region: 834-1129
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 7.33e-86
Family Complement components 0.0000188
Further Details:      
 
Domain Number 2 Region: 1203-1338
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.71e-34
Family Alpha-macroglobulin receptor domain 0.00087
Further Details:      
 
Domain Number 3 Region: 667-717
Classification Level Classification E-value
Superfamily E set domains 0.0000196
Family SVA-like 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Hsal_08868--XP_001122599.1_APIME
Sequence length 1382
Comment [mRNA] [translate_table: standard]
Sequence
MARYFTAIRNNLKCNNGTIGETTPGKYKLTARGLSGIHFEKSKDIDYVHKSHSVFIQTDR
AIYKPGHKVMFRCIILDSRLRPSIVGPTDVYIIDGDGNRIKQWIRPSVVHGIFSSELELS
ESPVLGSWKIVTNVGDQTFEKAFEVAEYVLPNFEVIIDSPKHSTFKESKVVATIYAKYTY
GEPVKGEATITAHPDIFSGVIQPIFQQPVRKVVPIDGKVTVDFDIKSELRLTDEYDRPIM
IDAVVEEALTGRRQNTSIQIMLHKHKYTMELIKTSEYFKPGLKYTAFLKLTYHDGSPVQD
TKNSVLIAYGYTYNQSAYTHITRMLDEHGMVQLDFYPPKPQDNTSFPLNIEAQYLNLHEW
FPSTNQATSLSNEYIQANLKTEKPMVNGNVEIEVNSTAPLKYISYEVLGRGDILDAGSIY
IQDKHTTSFEFLATYVMAPTAHVIVYYVRLDGEVIADSLDVELTGTLQNFVDLKVTSGEA
KPGDEVHITVSAKPDSYVGLLAVDQRSILLKSGNDLSHDQVYQELQSYDRADVSPYTDSF
FGRPLWRPGSGTADDIFQKTGVVILTNGYVHENFALRKYKVYYRSSLDGAIFASAAGASG
PTALPPEKVKVRKNFPETWLWETLDAGRTGQIDTRRKVPDSITSWVLTAFSLNDAHGLGL
IEEPRKLKVFRPFFISVDLPYSVMRGEIVAIQIAVFNYMNKDLTAEVLLKNEGQFDFAEV
SNEVNDAPRLELYRAKKVDVKANSGSSVSFMIIPRELGYIDIKVTASSVSASDGVAHKLL
VNAEGETQYRNKAVFLDLRNVDHVETNITIDIPNNAVPDSESIHISAVGDILGPSITNLA
NLIRMPFGCGEQNMLNFVPNIVVLNYLKNTNQLTQAVQSKALKYLDIGYQQELTYRHTDG
SFSAFGMSDPNGSTWLTAFVAKSFKQAAEYIMVENRIIDEALEWLSNNQAANGSFPEVGK
VSHRDMQGGAAKGLALTAYTLITFLENQDSTEKYRNTVNKAVDYIVRNIEGLNDTYALSL
CAYALNLAKHPFETSAFNYLESKAMTQQDLKWWSKPIPKDDKNPYYELPRSVDVEMTSYA
LLSYLRRNLLPDTIPVMKWLIKQRNPEGGFASTQDTVIGLQALAKLAEKLSRDIGSVPIV
FKHEGGQGYMNINGGNSMILQKQLLPKKTRQVNITASGKGFALVQVSYQYNLNVTGAWPL
FTLDPQVDKNSNANHLQLSICSGFVPTKETNESNMAVMEVSLPSGFTVDRDSLPSLEVSS
HVKRVETKYGDTMVVLYFDKMVQQEYCPTVSAFRVHKVAKQKPVPVSIYDYYDSSRRARV
FYEPIRTNLCDLCDGEDCDDICVSKPGKQKDNATVSVASRIYMCVYLQFILFSFYSLLYK
YV
Download sequence
Identical sequences E2BBY3
Hsal_08868--XP_001122599.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]