SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_12016--XP_624402.1_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_12016--XP_624402.1_APIME
Domain Number 1 Region: 1584-1798
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000105
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number 2 Region: 1440-1620
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000333
Family Tropomyosin 0.0016
Further Details:      
 
Weak hits

Sequence:  Hsal_12016--XP_624402.1_APIME
Domain Number - Region: 31-180
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.000136
Family HBL-like 0.023
Further Details:      
 
Domain Number - Region: 1118-1317
Classification Level Classification E-value
Superfamily Tropomyosin 0.00051
Family Tropomyosin 0.0027
Further Details:      
 
Domain Number - Region: 423-530
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00392
Family Myosin rod fragments 0.0057
Further Details:      
 
Domain Number - Region: 1370-1460
Classification Level Classification E-value
Superfamily Tropomyosin 0.0248
Family Tropomyosin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_12016--XP_624402.1_APIME
Sequence length 1926
Comment [mRNA] [translate_table: standard]
Sequence
MDSARSGGVIEEQGSDEDLSPDALVRQNYELRHRLEEEAASYKRRLDTYRQAQQHQAALV
SRLQAKVLQYKQRCSELENQMAETIPCDTTSKLTAATVSSTSVLDAAHQTLRDLREEQIH
DLDTALKKLGEEQRKCEKLLQLNASLKDQLEESHQTNETLTNDLQKLSNDWDILREELAI
KEDEWKEEEQAFNEYYTSEHNRLLNLWRDVVSVKRLFAEMKSATERDLSKLRNKIITSSN
EITSACNTTSFAIKLQANTMQPMPYQKIQQQEEGQTTSDLKIEIAALKQQYDTAQHEIRT
KEDRINQLIREIHNLEERCGVSEAAVTQTARMQEDIEVLQTALRDIAHAVIQDAESRDID
AKQAPPHIHLSPSGPIPQRSPKRGARSSTIPAFAESTISAVQAALHKYQLTIHELQVKLQ
MNKEQLLAMRKQCDTAEENAKSLNVKVAELISQLDTCRSQCTQLNQEKEMLQKGLDTIRL
EKNALDKNRVELNSMVEALNNDYDKLQKTNNKLQKMCDSLEDEKLYLQNELSRVSKDADL
RELSLRSEEDRCSKMREELLTLREDLSKAYLAKDMLEQQKLETDGLISQIEKSKGDLELE
LERILLEKSDVQEILIKIETMCSNHEQDKQRLQEELKKMTDEKNKLASQCIDQQGDLNSL
RKELLQAEQTRLDIESEKVTLNEKIKFLEIEKEKVEIELGQVTRERGDLSNQLSVLARKK
ETLNEELMRIRQRLEQSNEMNARINRNLEDLVKDNEEKQVLLETNEKEFQRLQEQLASMR
TEKETLEGVLFDTQTNLEATHVRKTQLEKEQKELLIKQESLKGQIARLTKELENSEKRAQ
DIKQSLTQQSGDQVAEFQQIISNMKKQSEDNIKKVNDEKEQVRMSLEKRLQQSLLQLEGE
KNEEINQLQQRIEELQQHIENLCKQHEEVLLRAENDKQQALLIAHHDQQALLEKLETIIR
ELEEEKSNLDRVKRDAASRAEQERNNTNQLRDELNRLRTKLDETKLRADEEKMKLDLKIE
ELWKERESIQREAEELQVQLHMAEDKVDGLQNQLHDTIRKLKDADNINETLRKELVDIRR
QLADTTYEKEKYNNSNKELREHVKRIESEKREQGRTLEELYQKISALEDARTNMDVERTR
LQTQVRDMERDALQLQQQLRFTQDELQKCHENNAQAQNEEKELQSRLANETEERERIQLQ
LHQVKKQVVDLDNSLEVTRQELGRLRTRADEEDERWHAREQELLVRLEDSRCRERKLEDQ
KHNLEVCLADATQQLQELKARLGGSEGRVRALDAQLSQLESSKKEVEQKLSSVGSTLRRI
AGIQMDGSVNMPFKLMSPSRRWSPARAQDHGDTSRDVIVDVDPEAVRKGVRSLMQQVAQI
ERERDDYKTELCSMKKQLTESQENQSNTDIKVNSLLANIRTLQEEKNSLEAKLTQKQTGY
QAQLEVLQQKTEECEQLYEKLTTLELKISTETEEKSQYEDKLEKMKQALSRLETEKRALQ
EEVGRSESRATKLELQRMSMEGDLQRLQMMLQEKDVQVQKLQDRTDAQSRTMASLEERCV
SLKSTIEQLNLALEKASATESELKGEINLLQRNIMEITTSSQNNNERLKQLQKQLSNTEN
DRRVLSERLETAQQTLSDLRHTNQSLTDQNARLQNELANNEVQRSALESQLRLSSWPQEG
SVSKDEELLRQLQTAQRERSEMRGKVDALSDKVKLLEADKRNLERQIASAKTNIIRSKSY
ERPEKAHVELLGTSYSLDNLEHENRELRLKVRRLETQLAEKEAELIRVKSTHVHSHSLLD
SSRDRSGELERIRAAQLQAEKLLEAREQSHRQQIQLLREQLNQEIKRRQLYVLRSSRAGR
EMQQLRQALGDSLRTVAQDPSLDAVLLEHEARKLDSTLASTASLPPSLALPAPPSYDRSS
TPSQLK
Download sequence
Identical sequences E2BI77
Hsal_12016--XP_624402.1_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]