SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Hsal_14903--XP_396685.2_APIME from Harpegnathos saltator v3.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Hsal_14903--XP_396685.2_APIME
Domain Number 1 Region: 48-168
Classification Level Classification E-value
Superfamily E set domains 0.0000231
Family Arrestin/Vps26-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Hsal_14903--XP_396685.2_APIME
Sequence length 384
Comment [mRNA] [translate_table: standard]
Sequence
MNYTNYFLLQSFFGFGQSADIEITLDGAETRKTADIKSEDGKKERHLLYYDGETVSGKIN
ISLRKAGKLEHQGVKVEFIGQIELYYDRGNHHEFTSLVKELARPGELTHNTIHTFEFPNV
EKPFESYTGSNVRLRYFLKVTIVRRLSDIVKELELVVHTLSSYPDMNNPIKMEVGIEDCL
HIEFEYNKSKYHLKDVIVGKIYFLLVRIKIKHMEIAIIKRETTGSGPHTFTENETIAKYE
IMDGAPVRGESIPIRVFLAGYDLAPTMRDINKKFSVRYYLNLVLMDEEDRRYFKQQEITL
WRKGEKSRKSQTASPHMPSHLVSAETGFPQGIAQNGPPSVSPIAPDQLPTSNITNVEDTT
APIEGMTREEGDGEGEKEDGPESD
Download sequence
Identical sequences E2C901
Hsal_14903--XP_396685.2_APIME

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]