SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70725627|ref|YP_252541.1| from Staphylococcus haemolyticus JCSC1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70725627|ref|YP_252541.1|
Domain Number 1 Region: 4-159
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 6.98e-23
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70725627|ref|YP_252541.1|
Sequence length 160
Comment hypothetical protein SH0626 [Staphylococcus haemolyticus JCSC1435]
Sequence
MAIQYKLEQLNHVRLIGVLRKYESGDEMQKDIPSFWQKVNNDGVVDDLIELSNQTLSGLL
GVILQKEDNHFEYFIGVPCDNSNNNDSHFNTLELSAHKYVVIDAKGKVPEAIKSITPKIY
QELLPQAKFKTIRAPMFEHYLPGNTQSSDYITEIWIPIED
Download sequence
Identical sequences A0A1F2L3M2 A0A2A1KD80 Q4L8U0
gi|70725627|ref|YP_252541.1| WP_011274951.1.10109 WP_011274951.1.101333 WP_011274951.1.101994 WP_011274951.1.1027 WP_011274951.1.10422 WP_011274951.1.11818 WP_011274951.1.1225 WP_011274951.1.12511 WP_011274951.1.12694 WP_011274951.1.12910 WP_011274951.1.13054 WP_011274951.1.1311 WP_011274951.1.1380 WP_011274951.1.14283 WP_011274951.1.14470 WP_011274951.1.14598 WP_011274951.1.15116 WP_011274951.1.15895 WP_011274951.1.16163 WP_011274951.1.16219 WP_011274951.1.16313 WP_011274951.1.16495 WP_011274951.1.18129 WP_011274951.1.18323 WP_011274951.1.18844 WP_011274951.1.19491 WP_011274951.1.1978 WP_011274951.1.19908 WP_011274951.1.20173 WP_011274951.1.20471 WP_011274951.1.20834 WP_011274951.1.21698 WP_011274951.1.22102 WP_011274951.1.23003 WP_011274951.1.2357 WP_011274951.1.23919 WP_011274951.1.25922 WP_011274951.1.26373 WP_011274951.1.28455 WP_011274951.1.28860 WP_011274951.1.297 WP_011274951.1.30324 WP_011274951.1.31052 WP_011274951.1.31288 WP_011274951.1.31494 WP_011274951.1.35058 WP_011274951.1.35706 WP_011274951.1.3637 WP_011274951.1.36410 WP_011274951.1.36612 WP_011274951.1.36734 WP_011274951.1.36837 WP_011274951.1.36913 WP_011274951.1.37394 WP_011274951.1.37871 WP_011274951.1.39200 WP_011274951.1.39440 WP_011274951.1.40163 WP_011274951.1.402 WP_011274951.1.4220 WP_011274951.1.42727 WP_011274951.1.43577 WP_011274951.1.43780 WP_011274951.1.44205 WP_011274951.1.44226 WP_011274951.1.44543 WP_011274951.1.4581 WP_011274951.1.48297 WP_011274951.1.48683 WP_011274951.1.49011 WP_011274951.1.49079 WP_011274951.1.49577 WP_011274951.1.49716 WP_011274951.1.510 WP_011274951.1.51540 WP_011274951.1.51872 WP_011274951.1.51997 WP_011274951.1.52374 WP_011274951.1.52664 WP_011274951.1.53148 WP_011274951.1.53191 WP_011274951.1.53313 WP_011274951.1.54595 WP_011274951.1.55678 WP_011274951.1.5596 WP_011274951.1.58879 WP_011274951.1.589 WP_011274951.1.58915 WP_011274951.1.60041 WP_011274951.1.61337 WP_011274951.1.61390 WP_011274951.1.63295 WP_011274951.1.63323 WP_011274951.1.6358 WP_011274951.1.63725 WP_011274951.1.64661 WP_011274951.1.64835 WP_011274951.1.64863 WP_011274951.1.65972 WP_011274951.1.66148 WP_011274951.1.66202 WP_011274951.1.66833 WP_011274951.1.67078 WP_011274951.1.67111 WP_011274951.1.67157 WP_011274951.1.67271 WP_011274951.1.67478 WP_011274951.1.67846 WP_011274951.1.68076 WP_011274951.1.68328 WP_011274951.1.68612 WP_011274951.1.69277 WP_011274951.1.69544 WP_011274951.1.7082 WP_011274951.1.70824 WP_011274951.1.71127 WP_011274951.1.7114 WP_011274951.1.73426 WP_011274951.1.74301 WP_011274951.1.74446 WP_011274951.1.74601 WP_011274951.1.74627 WP_011274951.1.74640 WP_011274951.1.75368 WP_011274951.1.76890 WP_011274951.1.76990 WP_011274951.1.77553 WP_011274951.1.77591 WP_011274951.1.77635 WP_011274951.1.78694 WP_011274951.1.79350 WP_011274951.1.81145 WP_011274951.1.81188 WP_011274951.1.8193 WP_011274951.1.81983 WP_011274951.1.82096 WP_011274951.1.82332 WP_011274951.1.82878 WP_011274951.1.83289 WP_011274951.1.83870 WP_011274951.1.84269 WP_011274951.1.84838 WP_011274951.1.85768 WP_011274951.1.87015 WP_011274951.1.8732 WP_011274951.1.87507 WP_011274951.1.88266 WP_011274951.1.88267 WP_011274951.1.8871 WP_011274951.1.89180 WP_011274951.1.8934 WP_011274951.1.89666 WP_011274951.1.90039 WP_011274951.1.90041 WP_011274951.1.90558 WP_011274951.1.91141 WP_011274951.1.91567 WP_011274951.1.92193 WP_011274951.1.92210 WP_011274951.1.92713 WP_011274951.1.9312 WP_011274951.1.93353 WP_011274951.1.93901 WP_011274951.1.94858 WP_011274951.1.96210 WP_011274951.1.98145 279808.SH0626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]