SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70726158|ref|YP_253072.1| from Staphylococcus haemolyticus JCSC1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70726158|ref|YP_253072.1|
Domain Number 1 Region: 36-302
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.18e-67
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|70726158|ref|YP_253072.1|
Sequence length 333
Comment hypothetical protein SH1157 [Staphylococcus haemolyticus JCSC1435]
Sequence
MSLFKNFFIALSNSTYLNETAKKVGPKMGANKVVAGNTIEQLIDTIERLNDKNIAVTVDN
LGEFVGTVEEATQAKNEILEVMQAIKDYNVDAHMSVKLSSLGGEFDTELAYNNLREILLK
ANEFDNMHINIDTEKYDSLQQIVEVLDRLKGEFRNVGTVIQAYLYDAVDLIDKYPNLRLR
LVKGAYKEDEQIAYQTKEEIDANYIKIIEKRLLTAKNYTSIATHDDQIINHVKQFVKSHN
IDRDQFEFQMLYGFRSELAEDISRQGYHFTIYVPYGNDWFGYFMRRLAERPQNLALAYQE
FVSTKTLKKIGVFTSLGLGAAFIISGLTRLLKR
Download sequence
Identical sequences A0A1F2KR06 A0A2J9WWF5 Q4L7A9
279808.SH1157 gi|70726158|ref|YP_253072.1| WP_011275458.1.10109 WP_011275458.1.101333 WP_011275458.1.101994 WP_011275458.1.1027 WP_011275458.1.10422 WP_011275458.1.11818 WP_011275458.1.1225 WP_011275458.1.12511 WP_011275458.1.12694 WP_011275458.1.12910 WP_011275458.1.13054 WP_011275458.1.1311 WP_011275458.1.1380 WP_011275458.1.14283 WP_011275458.1.14470 WP_011275458.1.15116 WP_011275458.1.15895 WP_011275458.1.16163 WP_011275458.1.16219 WP_011275458.1.16313 WP_011275458.1.16495 WP_011275458.1.18129 WP_011275458.1.18323 WP_011275458.1.18844 WP_011275458.1.19491 WP_011275458.1.1978 WP_011275458.1.19908 WP_011275458.1.20173 WP_011275458.1.20471 WP_011275458.1.20834 WP_011275458.1.20864 WP_011275458.1.21698 WP_011275458.1.22102 WP_011275458.1.23003 WP_011275458.1.2357 WP_011275458.1.23919 WP_011275458.1.25922 WP_011275458.1.26373 WP_011275458.1.28455 WP_011275458.1.28860 WP_011275458.1.297 WP_011275458.1.30324 WP_011275458.1.31052 WP_011275458.1.31288 WP_011275458.1.31494 WP_011275458.1.35058 WP_011275458.1.35706 WP_011275458.1.3637 WP_011275458.1.36410 WP_011275458.1.36612 WP_011275458.1.36734 WP_011275458.1.36837 WP_011275458.1.36913 WP_011275458.1.37394 WP_011275458.1.39200 WP_011275458.1.39440 WP_011275458.1.40163 WP_011275458.1.402 WP_011275458.1.4220 WP_011275458.1.42727 WP_011275458.1.43577 WP_011275458.1.43780 WP_011275458.1.44205 WP_011275458.1.44226 WP_011275458.1.44543 WP_011275458.1.4581 WP_011275458.1.48297 WP_011275458.1.48683 WP_011275458.1.49011 WP_011275458.1.49079 WP_011275458.1.49577 WP_011275458.1.49716 WP_011275458.1.510 WP_011275458.1.51540 WP_011275458.1.51872 WP_011275458.1.51997 WP_011275458.1.52374 WP_011275458.1.52664 WP_011275458.1.53148 WP_011275458.1.53191 WP_011275458.1.53313 WP_011275458.1.54595 WP_011275458.1.55678 WP_011275458.1.5596 WP_011275458.1.58879 WP_011275458.1.589 WP_011275458.1.58915 WP_011275458.1.60041 WP_011275458.1.61337 WP_011275458.1.61390 WP_011275458.1.63295 WP_011275458.1.6358 WP_011275458.1.63725 WP_011275458.1.64661 WP_011275458.1.64835 WP_011275458.1.64863 WP_011275458.1.65972 WP_011275458.1.66148 WP_011275458.1.66202 WP_011275458.1.66833 WP_011275458.1.67078 WP_011275458.1.67111 WP_011275458.1.67478 WP_011275458.1.68328 WP_011275458.1.68612 WP_011275458.1.69277 WP_011275458.1.69544 WP_011275458.1.7082 WP_011275458.1.71127 WP_011275458.1.7114 WP_011275458.1.73426 WP_011275458.1.74301 WP_011275458.1.74446 WP_011275458.1.74601 WP_011275458.1.74627 WP_011275458.1.74640 WP_011275458.1.75368 WP_011275458.1.76890 WP_011275458.1.76990 WP_011275458.1.77553 WP_011275458.1.77591 WP_011275458.1.77635 WP_011275458.1.78694 WP_011275458.1.79350 WP_011275458.1.81145 WP_011275458.1.81188 WP_011275458.1.8193 WP_011275458.1.81983 WP_011275458.1.82096 WP_011275458.1.82332 WP_011275458.1.82878 WP_011275458.1.83289 WP_011275458.1.84269 WP_011275458.1.84838 WP_011275458.1.87015 WP_011275458.1.8732 WP_011275458.1.87507 WP_011275458.1.88266 WP_011275458.1.88267 WP_011275458.1.8871 WP_011275458.1.89180 WP_011275458.1.8934 WP_011275458.1.89666 WP_011275458.1.90039 WP_011275458.1.90558 WP_011275458.1.91141 WP_011275458.1.91567 WP_011275458.1.92193 WP_011275458.1.92210 WP_011275458.1.92713 WP_011275458.1.92797 WP_011275458.1.9312 WP_011275458.1.93353 WP_011275458.1.93901 WP_011275458.1.94858 WP_011275458.1.96210 WP_011275458.1.98145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]