SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70726411|ref|YP_253325.1| from Staphylococcus haemolyticus JCSC1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70726411|ref|YP_253325.1|
Domain Number 1 Region: 169-282
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000000225
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.034
Further Details:      
 
Domain Number 2 Region: 5-54
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000318
Family AraC type transcriptional activator 0.012
Further Details:      
 
Weak hits

Sequence:  gi|70726411|ref|YP_253325.1|
Domain Number - Region: 58-103
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000381
Family AraC type transcriptional activator 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70726411|ref|YP_253325.1|
Sequence length 287
Comment hypothetical protein SH1410 [Staphylococcus haemolyticus JCSC1435]
Sequence
MDVIKQIQQAIVFIEDRLLEPFNLQDLSDYVGLSPYHLDQSFKMIVGQSPEQYAHARKMT
AAAKEMVQSSSRLVDVAKKYNYHSSNDFANDFSDFHGISPIQASTKKDELKLQERLYIKL
TTTERAPYPYRLDTTEDIALVGYVRYIESNNLSNPYKVPDFLEDLILDGKIKDLKRYNNI
SPYELFVITCPLDNGLELFIGVPSDRYPSHLESRILPGRHYAKFNLQGEIDYAVNEAWYY
IESSLQLTLPYERDSLYVEIYPFDISFEDPFTKIQLWLPIEQENYDL
Download sequence
Identical sequences A0A1F2KSY3 A0A2A1K8Z1 Q4L6K6
gi|70726411|ref|YP_253325.1| 279808.SH1410 WP_011275706.1.10109 WP_011275706.1.101333 WP_011275706.1.101994 WP_011275706.1.11818 WP_011275706.1.1225 WP_011275706.1.12511 WP_011275706.1.12694 WP_011275706.1.12910 WP_011275706.1.1311 WP_011275706.1.1380 WP_011275706.1.14470 WP_011275706.1.14598 WP_011275706.1.15895 WP_011275706.1.16163 WP_011275706.1.16219 WP_011275706.1.16313 WP_011275706.1.16495 WP_011275706.1.18129 WP_011275706.1.18323 WP_011275706.1.18844 WP_011275706.1.1978 WP_011275706.1.19908 WP_011275706.1.20471 WP_011275706.1.20834 WP_011275706.1.20864 WP_011275706.1.21698 WP_011275706.1.22102 WP_011275706.1.23003 WP_011275706.1.2357 WP_011275706.1.25922 WP_011275706.1.26373 WP_011275706.1.28860 WP_011275706.1.29037 WP_011275706.1.297 WP_011275706.1.30324 WP_011275706.1.31052 WP_011275706.1.31494 WP_011275706.1.35706 WP_011275706.1.3637 WP_011275706.1.36410 WP_011275706.1.36612 WP_011275706.1.36734 WP_011275706.1.36837 WP_011275706.1.36913 WP_011275706.1.37394 WP_011275706.1.37871 WP_011275706.1.39200 WP_011275706.1.39440 WP_011275706.1.40163 WP_011275706.1.402 WP_011275706.1.4220 WP_011275706.1.42727 WP_011275706.1.43577 WP_011275706.1.43780 WP_011275706.1.44205 WP_011275706.1.44226 WP_011275706.1.44543 WP_011275706.1.4581 WP_011275706.1.48297 WP_011275706.1.48683 WP_011275706.1.49011 WP_011275706.1.49079 WP_011275706.1.49577 WP_011275706.1.49716 WP_011275706.1.51540 WP_011275706.1.51872 WP_011275706.1.52374 WP_011275706.1.52664 WP_011275706.1.53148 WP_011275706.1.53191 WP_011275706.1.53313 WP_011275706.1.55678 WP_011275706.1.5596 WP_011275706.1.589 WP_011275706.1.58915 WP_011275706.1.61337 WP_011275706.1.61390 WP_011275706.1.63295 WP_011275706.1.63323 WP_011275706.1.6358 WP_011275706.1.63725 WP_011275706.1.64661 WP_011275706.1.64835 WP_011275706.1.64863 WP_011275706.1.65972 WP_011275706.1.66148 WP_011275706.1.66202 WP_011275706.1.66833 WP_011275706.1.67078 WP_011275706.1.67111 WP_011275706.1.67271 WP_011275706.1.67478 WP_011275706.1.67846 WP_011275706.1.68076 WP_011275706.1.68328 WP_011275706.1.68612 WP_011275706.1.69277 WP_011275706.1.69544 WP_011275706.1.7082 WP_011275706.1.71127 WP_011275706.1.7114 WP_011275706.1.73426 WP_011275706.1.74301 WP_011275706.1.74446 WP_011275706.1.74627 WP_011275706.1.74640 WP_011275706.1.75368 WP_011275706.1.76890 WP_011275706.1.77553 WP_011275706.1.77591 WP_011275706.1.77635 WP_011275706.1.78694 WP_011275706.1.79350 WP_011275706.1.81145 WP_011275706.1.81188 WP_011275706.1.8193 WP_011275706.1.81983 WP_011275706.1.82096 WP_011275706.1.82878 WP_011275706.1.83289 WP_011275706.1.83870 WP_011275706.1.84269 WP_011275706.1.84838 WP_011275706.1.85768 WP_011275706.1.87507 WP_011275706.1.88267 WP_011275706.1.8871 WP_011275706.1.89180 WP_011275706.1.8934 WP_011275706.1.89666 WP_011275706.1.90558 WP_011275706.1.91141 WP_011275706.1.91567 WP_011275706.1.92193 WP_011275706.1.92210 WP_011275706.1.92713 WP_011275706.1.92797 WP_011275706.1.9312 WP_011275706.1.93353 WP_011275706.1.93901 WP_011275706.1.94858 WP_011275706.1.96210 WP_011275706.1.98145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]