SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70727078|ref|YP_253992.1| from Staphylococcus haemolyticus JCSC1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|70727078|ref|YP_253992.1|
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 4.71e-24
Family Rob transcription factor, C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70727078|ref|YP_253992.1|
Sequence length 152
Comment hypothetical protein SH2077 [Staphylococcus haemolyticus JCSC1435]
Sequence
MNYKIEVLDDCNVIYVRNKGKYGSNKNYEMMKNFKEWIKENSYWRYVETNGILGVALDDP
QIVEEESCRYDLVLKIDEDVKINDFINSRSFTGGKYVVFAIPHTTKDVKDFYSNLPNIID
NNNLRVKHEPILERYKEEEGKDKYCEILIPVL
Download sequence
Identical sequences Q4L4N9
gi|70727078|ref|YP_253992.1| WP_011276341.1.101333 WP_011276341.1.68328 WP_011276341.1.79350 WP_011276341.1.8193 WP_011276341.1.84838 279808.SH2077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]