SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|70727600|ref|YP_254516.1| from Staphylococcus haemolyticus JCSC1435

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|70727600|ref|YP_254516.1|
Domain Number - Region: 20-120
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000732
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|70727600|ref|YP_254516.1|
Sequence length 127
Comment hypothetical protein SH2601 [Staphylococcus haemolyticus JCSC1435]
Sequence
MKLYVNEIVRTNNFEDDDIMNKILGMWDTFYKNNDDYKGKVYAIYHDYESDYKGDYSLAL
CTEDISADKFFEVDFANSIEYKCSGKDEIVNVWKRIWEDEEENKIQRRYDIDCEEYKEDG
SVVIHLF
Download sequence
Identical sequences A0A2A1K6N4 Q4L367
WP_011276846.1.101333 WP_011276846.1.101994 WP_011276846.1.1027 WP_011276846.1.10422 WP_011276846.1.1225 WP_011276846.1.13054 WP_011276846.1.1311 WP_011276846.1.14283 WP_011276846.1.15116 WP_011276846.1.16163 WP_011276846.1.18129 WP_011276846.1.19491 WP_011276846.1.19908 WP_011276846.1.20173 WP_011276846.1.20888 WP_011276846.1.22102 WP_011276846.1.23919 WP_011276846.1.28455 WP_011276846.1.30324 WP_011276846.1.31052 WP_011276846.1.31494 WP_011276846.1.35058 WP_011276846.1.35706 WP_011276846.1.36410 WP_011276846.1.36612 WP_011276846.1.37394 WP_011276846.1.39200 WP_011276846.1.42727 WP_011276846.1.43577 WP_011276846.1.43780 WP_011276846.1.44205 WP_011276846.1.44543 WP_011276846.1.4581 WP_011276846.1.48297 WP_011276846.1.48683 WP_011276846.1.49079 WP_011276846.1.51540 WP_011276846.1.51997 WP_011276846.1.52374 WP_011276846.1.53148 WP_011276846.1.53191 WP_011276846.1.54595 WP_011276846.1.55678 WP_011276846.1.5596 WP_011276846.1.58879 WP_011276846.1.589 WP_011276846.1.60041 WP_011276846.1.61337 WP_011276846.1.61390 WP_011276846.1.63725 WP_011276846.1.64835 WP_011276846.1.65972 WP_011276846.1.66202 WP_011276846.1.67111 WP_011276846.1.67157 WP_011276846.1.67478 WP_011276846.1.67846 WP_011276846.1.68328 WP_011276846.1.69277 WP_011276846.1.70824 WP_011276846.1.71127 WP_011276846.1.74601 WP_011276846.1.74627 WP_011276846.1.75368 WP_011276846.1.76890 WP_011276846.1.76990 WP_011276846.1.77553 WP_011276846.1.78694 WP_011276846.1.79350 WP_011276846.1.81188 WP_011276846.1.8193 WP_011276846.1.81983 WP_011276846.1.82332 WP_011276846.1.82878 WP_011276846.1.83289 WP_011276846.1.84838 WP_011276846.1.85768 WP_011276846.1.87015 WP_011276846.1.8732 WP_011276846.1.87507 WP_011276846.1.88266 WP_011276846.1.8871 WP_011276846.1.89180 WP_011276846.1.8934 WP_011276846.1.90039 WP_011276846.1.91567 WP_011276846.1.92193 WP_011276846.1.9312 279808.SH2601 gi|70727600|ref|YP_254516.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]